BLASTX nr result
ID: Ophiopogon26_contig00046809
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046809 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52520.1| hypothetical protein RirG_252460 [Rhizophagus irr... 175 9e-54 >gb|EXX52520.1| hypothetical protein RirG_252460 [Rhizophagus irregularis DAOM 197198w] dbj|GBC28878.1| hypothetical protein RIR_1470900 [Rhizophagus irregularis DAOM 181602] gb|PKC08642.1| hypothetical protein RhiirA5_399176 [Rhizophagus irregularis] gb|PKC70744.1| hypothetical protein RhiirA1_413998 [Rhizophagus irregularis] gb|PKK73884.1| hypothetical protein RhiirC2_864172 [Rhizophagus irregularis] gb|PKY17678.1| hypothetical protein RhiirB3_404609 [Rhizophagus irregularis] gb|PKY47542.1| hypothetical protein RhiirA4_403546 [Rhizophagus irregularis] gb|POG70224.1| hypothetical protein GLOIN_2v1841876 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 174 Score = 175 bits (444), Expect = 9e-54 Identities = 85/89 (95%), Positives = 88/89 (98%) Frame = -2 Query: 377 FYKNGLLRPTYQSFTAFSTLVTGSILLPILVLVGDLIFMFTVVIASVGAVVMTMYGGLEC 198 FYKNGLLRPTYQSFTAFSTLVTGSILLPILVLVGDLIFMFTVVIASVGAVVMTMYGGLEC Sbjct: 78 FYKNGLLRPTYQSFTAFSTLVTGSILLPILVLVGDLIFMFTVVIASVGAVVMTMYGGLEC 137 Query: 197 GIEFCNRVAMSVPETYWEMIFPPENPEKR 111 GIEFCNRVAMSVPETYWEMIFP +NPE++ Sbjct: 138 GIEFCNRVAMSVPETYWEMIFPSKNPEEK 166