BLASTX nr result
ID: Ophiopogon26_contig00046711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046711 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC17317.1| Tis13_346807 [Rhizophagus irregularis DAOM 18160... 73 5e-14 gb|PKC01673.1| hypothetical protein RhiirA5_364742, partial [Rhi... 72 2e-13 dbj|GBC17300.1| Tis13_344761 [Rhizophagus irregularis DAOM 18160... 72 2e-13 >dbj|GBC17317.1| Tis13_346807 [Rhizophagus irregularis DAOM 181602] gb|PKC01162.1| hypothetical protein RhiirA5_365162 [Rhizophagus irregularis] gb|PKC59582.1| hypothetical protein RhiirA1_426800 [Rhizophagus irregularis] gb|PKK60975.1| hypothetical protein RhiirC2_761234 [Rhizophagus irregularis] gb|PKY30060.1| hypothetical protein RhiirB3_418503 [Rhizophagus irregularis] gb|PKY53424.1| hypothetical protein RhiirA4_409051 [Rhizophagus irregularis] Length = 67 Score = 72.8 bits (177), Expect = 5e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 458 IGSVISDATELFEEVLNRIENHEDKKQRKNYLTKFIRTL 342 +GSVISDAT+LFEEVL RIENHEDKKQRKNYL KFIRTL Sbjct: 1 MGSVISDATDLFEEVLQRIENHEDKKQRKNYLMKFIRTL 39 >gb|PKC01673.1| hypothetical protein RhiirA5_364742, partial [Rhizophagus irregularis] gb|PKY23812.1| hypothetical protein RhiirB3_412304, partial [Rhizophagus irregularis] Length = 79 Score = 71.6 bits (174), Expect = 2e-13 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = -2 Query: 506 MSMYQQDNISKETIATIGSVISDATELFEEVLNRIENHEDKKQRKNYLTKFIRTL 342 M+MY+ +N+S ETIATIGSVIS+ATE FEEVLN+IEN DK+QR L K+ RT+ Sbjct: 1 MNMYRLNNLSNETIATIGSVISNATEEFEEVLNQIENQGDKQQRTYNLRKYYRTI 55 >dbj|GBC17300.1| Tis13_344761 [Rhizophagus irregularis DAOM 181602] gb|PKK66570.1| hypothetical protein RhiirC2_753252 [Rhizophagus irregularis] gb|PKY46471.1| hypothetical protein RhiirA4_402530 [Rhizophagus irregularis] Length = 81 Score = 71.6 bits (174), Expect = 2e-13 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = -2 Query: 506 MSMYQQDNISKETIATIGSVISDATELFEEVLNRIENHEDKKQRKNYLTKFIRTL 342 M+MY+ +N+S ETIATIGSVIS+ATE FEEVLN+IEN DK+QR L K+ RT+ Sbjct: 1 MNMYRLNNLSNETIATIGSVISNATEEFEEVLNQIENQGDKQQRTYNLRKYYRTI 55