BLASTX nr result
ID: Ophiopogon26_contig00046600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046600 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252068.1| transcriptional regulator SUPERMAN-like [Asp... 75 1e-13 ref|XP_010907804.2| PREDICTED: uncharacterized protein LOC105034... 55 6e-06 ref|XP_020677499.1| transcriptional regulator SUPERMAN-like [Den... 54 6e-06 >ref|XP_020252068.1| transcriptional regulator SUPERMAN-like [Asparagus officinalis] Length = 242 Score = 75.5 bits (184), Expect = 1e-13 Identities = 35/48 (72%), Positives = 40/48 (83%), Gaps = 3/48 (6%) Frame = -2 Query: 136 MNSAMEQTRYWMWTRRKFNN---TRTPPPLFNSPITTIAATSSYHESW 2 MNSAMEQTRYWMW R+K NN TR PPPLFNSP+ I+++SSYHESW Sbjct: 1 MNSAMEQTRYWMWARKKLNNNNTTRPPPPLFNSPL--ISSSSSYHESW 46 >ref|XP_010907804.2| PREDICTED: uncharacterized protein LOC105034368 [Elaeis guineensis] Length = 282 Score = 54.7 bits (130), Expect = 6e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 136 MNSAMEQTRYWMWTRRKFNNTRTPPPLFNSPITTIAATSSYHESW 2 M+S MEQTRYWMWTRRK + RT LF SP+ I+ +SSY++SW Sbjct: 1 MHSDMEQTRYWMWTRRK-SGERT---LFGSPLHQISTSSSYNDSW 41 >ref|XP_020677499.1| transcriptional regulator SUPERMAN-like [Dendrobium catenatum] Length = 233 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 6/51 (11%) Frame = -2 Query: 136 MNSAMEQTRYWMWTRRKFNNTRTPPPLFNS------PITTIAATSSYHESW 2 M+SAMEQT+YWMWTRRK+ PLF+S P + +AAT+ Y+ESW Sbjct: 1 MHSAMEQTKYWMWTRRKY---PVRAPLFDSLTSTPIPASAVAATAFYNESW 48