BLASTX nr result
ID: Ophiopogon26_contig00046571
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046571 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY34521.1| hypothetical protein RhiirB3_395602 [Rhizophagus ... 79 7e-14 >gb|PKY34521.1| hypothetical protein RhiirB3_395602 [Rhizophagus irregularis] Length = 490 Score = 78.6 bits (192), Expect = 7e-14 Identities = 38/57 (66%), Positives = 43/57 (75%) Frame = -2 Query: 217 QGNHLPPRTGADTSEFSKVIGSTFAAKDWSRHE*LLVIKQLITSPPRTEADMKLWRL 47 QG H PP G D S+FSKVIGST AK +RHE LLV+KQLITSPPR+ D+KLW L Sbjct: 12 QGKHSPPGPGTDVSDFSKVIGSTVTAKALNRHEQLLVVKQLITSPPRSGTDIKLWLL 68