BLASTX nr result
ID: Ophiopogon26_contig00046423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046423 (1193 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC62816.1| hypothetical protein RhiirA1_423425 [Rhizophagus ... 82 9e-16 gb|PKB97474.1| hypothetical protein RhiirA5_367434 [Rhizophagus ... 81 1e-15 dbj|GBC50523.1| Tis13_350259 [Rhizophagus irregularis DAOM 181602] 80 4e-15 gb|POG73653.1| hypothetical protein GLOIN_2v1874265 [Rhizophagus... 70 9e-10 dbj|GBC16414.1| hypothetical protein RIR_0457400 [Rhizophagus ir... 70 3e-09 gb|PKY32664.1| hypothetical protein RhiirB3_492587 [Rhizophagus ... 68 1e-08 dbj|GBC16478.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 68 1e-08 gb|PKB94631.1| hypothetical protein RhiirA5_438350, partial [Rhi... 68 1e-08 gb|PKY34253.1| hypothetical protein RhiirB3_453794 [Rhizophagus ... 68 1e-08 gb|PKC54931.1| hypothetical protein RhiirA1_504966 [Rhizophagus ... 68 1e-08 gb|PKB96073.1| hypothetical protein RhiirA5_435508 [Rhizophagus ... 68 1e-08 gb|PKY53706.1| hypothetical protein RhiirA4_472068 [Rhizophagus ... 66 6e-08 >gb|PKC62816.1| hypothetical protein RhiirA1_423425 [Rhizophagus irregularis] gb|PKK60680.1| hypothetical protein RhiirC2_761548 [Rhizophagus irregularis] gb|PKY24071.1| hypothetical protein RhiirB3_412615 [Rhizophagus irregularis] gb|PKY49722.1| hypothetical protein RhiirA4_405763 [Rhizophagus irregularis] Length = 68 Score = 81.6 bits (200), Expect = 9e-16 Identities = 48/73 (65%), Positives = 50/73 (68%) Frame = +2 Query: 512 MVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIVGIIYISYDIEGFSSHVDVKDASR 691 M TPLIDPGSFL+LINLQHLEIVNHDGNESYSRYK V ISYDIE F R Sbjct: 1 MTTPLIDPGSFLNLINLQHLEIVNHDGNESYSRYKNVD---ISYDIERF-----FITRGR 52 Query: 692 KQILKEQRFIRKK 730 K +KE F R K Sbjct: 53 KGRIKETDFERTK 65 >gb|PKB97474.1| hypothetical protein RhiirA5_367434 [Rhizophagus irregularis] Length = 68 Score = 81.3 bits (199), Expect = 1e-15 Identities = 47/73 (64%), Positives = 50/73 (68%) Frame = +2 Query: 512 MVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIVGIIYISYDIEGFSSHVDVKDASR 691 M TPLIDPGSFL+LINLQHLEI+NHDGNESYSRYK V ISYDIE F R Sbjct: 1 MTTPLIDPGSFLNLINLQHLEIINHDGNESYSRYKNVD---ISYDIERF-----FITRGR 52 Query: 692 KQILKEQRFIRKK 730 K +KE F R K Sbjct: 53 KGRIKETDFERTK 65 >dbj|GBC50523.1| Tis13_350259 [Rhizophagus irregularis DAOM 181602] Length = 68 Score = 79.7 bits (195), Expect = 4e-15 Identities = 47/73 (64%), Positives = 50/73 (68%) Frame = +2 Query: 512 MVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIVGIIYISYDIEGFSSHVDVKDASR 691 M TPLIDPGSFL+LINLQHLEIVNHDGNESYSRYK V ISY+IE F R Sbjct: 1 MTTPLIDPGSFLNLINLQHLEIVNHDGNESYSRYKNVD---ISYNIERF-----FITRGR 52 Query: 692 KQILKEQRFIRKK 730 K +KE F R K Sbjct: 53 KGHIKETDFERTK 65 >gb|POG73653.1| hypothetical protein GLOIN_2v1874265 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 261 Score = 69.7 bits (169), Expect = 9e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDGNE Y+ YK V Sbjct: 33 LKTLMTTPLIDPGSFLSLINLQHLELINHDGNEPYNCYKNV 73 >dbj|GBC16414.1| hypothetical protein RIR_0457400 [Rhizophagus irregularis DAOM 181602] Length = 468 Score = 69.7 bits (169), Expect = 3e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDGNE Y+ YK V Sbjct: 240 LKTLMTTPLIDPGSFLSLINLQHLELINHDGNEPYNCYKNV 280 >gb|PKY32664.1| hypothetical protein RhiirB3_492587 [Rhizophagus irregularis] Length = 451 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDG+E Y+ YK V Sbjct: 250 LKTLMTTPLIDPGSFLSLINLQHLELINHDGDEPYNCYKNV 290 >dbj|GBC16478.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 468 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDG+E Y+ YK V Sbjct: 240 LKTLMTTPLIDPGSFLSLINLQHLELINHDGDEPYNCYKNV 280 >gb|PKB94631.1| hypothetical protein RhiirA5_438350, partial [Rhizophagus irregularis] gb|PKB95167.1| hypothetical protein RhiirA5_437240, partial [Rhizophagus irregularis] gb|PKB95170.1| hypothetical protein RhiirA5_437233, partial [Rhizophagus irregularis] Length = 474 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDG+E Y+ YK V Sbjct: 250 LKTLMTTPLIDPGSFLSLINLQHLELINHDGDEPYNCYKNV 290 >gb|PKY34253.1| hypothetical protein RhiirB3_453794 [Rhizophagus irregularis] Length = 478 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDG+E Y+ YK V Sbjct: 250 LKTLMTTPLIDPGSFLSLINLQHLELINHDGDEPYNCYKNV 290 >gb|PKC54931.1| hypothetical protein RhiirA1_504966 [Rhizophagus irregularis] Length = 478 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDG+E Y+ YK V Sbjct: 250 LKTLMTTPLIDPGSFLSLINLQHLELINHDGDEPYNCYKNV 290 >gb|PKB96073.1| hypothetical protein RhiirA5_435508 [Rhizophagus irregularis] gb|PKB96865.1| hypothetical protein RhiirA5_434103 [Rhizophagus irregularis] Length = 478 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSLINLQHLE++NHDG+E Y+ YK V Sbjct: 250 LKTLMTTPLIDPGSFLSLINLQHLELINHDGDEPYNCYKNV 290 >gb|PKY53706.1| hypothetical protein RhiirA4_472068 [Rhizophagus irregularis] Length = 466 Score = 65.9 bits (159), Expect = 6e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 500 LKIFMVTPLIDPGSFLSLINLQHLEIVNHDGNESYSRYKIV 622 LK M TPLIDPGSFLSL NLQHLE++NHDG+E Y+ YK V Sbjct: 238 LKTLMTTPLIDPGSFLSLTNLQHLELINHDGDEPYNCYKNV 278