BLASTX nr result
ID: Ophiopogon26_contig00046301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046301 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276434.1| UPF0481 protein At3g47200-like [Asparagus of... 63 2e-08 gb|ONK64977.1| uncharacterized protein A4U43_C07F32100 [Asparagu... 63 2e-08 ref|XP_020256171.1| UPF0481 protein At3g47200-like [Asparagus of... 55 1e-05 >ref|XP_020276434.1| UPF0481 protein At3g47200-like [Asparagus officinalis] Length = 486 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 491 SDGNYLADVFIQVKKYHGSSWRRWRAQLIHNYFIHPWA 378 SD NYL DVF++VKKYH S W RWRA LI +YF +PWA Sbjct: 420 SDMNYLGDVFVKVKKYHESKWHRWRAGLIRDYFSNPWA 457 >gb|ONK64977.1| uncharacterized protein A4U43_C07F32100 [Asparagus officinalis] Length = 621 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 491 SDGNYLADVFIQVKKYHGSSWRRWRAQLIHNYFIHPWA 378 SD NYL DVF++VKKYH S W RWRA LI +YF +PWA Sbjct: 420 SDMNYLGDVFVKVKKYHESKWHRWRAGLIRDYFSNPWA 457 >ref|XP_020256171.1| UPF0481 protein At3g47200-like [Asparagus officinalis] Length = 506 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -2 Query: 491 SDGNYLADVFIQVKKYHGSSWRRWRAQLIHNYFIHPW 381 SDGNYLAD+F VKK H S WRRWRA L YF + W Sbjct: 437 SDGNYLADIFTNVKKDHESKWRRWRAGLARVYFSNYW 473