BLASTX nr result
ID: Ophiopogon26_contig00046138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046138 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG78229.1| hypothetical protein GLOIN_2v1540332, partial [Rh... 83 2e-17 >gb|POG78229.1| hypothetical protein GLOIN_2v1540332, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 72 Score = 82.8 bits (203), Expect = 2e-17 Identities = 46/63 (73%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = -2 Query: 429 TRTHSPVFSFLCMPKERDLRESLLSYNYDL*DDT*HLHYIS--CTRKIYIYSSDPSQLLS 256 TRTHSPVFSFLCMPKERDL ESLLSYNY +T LH S + IYIYSSDP QLLS Sbjct: 14 TRTHSPVFSFLCMPKERDLSESLLSYNY----ETTALHLTSHVLEKYIYIYSSDPPQLLS 69 Query: 255 IFQ 247 IFQ Sbjct: 70 IFQ 72