BLASTX nr result
ID: Ophiopogon26_contig00045486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00045486 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX67633.1| hypothetical protein RirG_112540 [Rhizophagus irr... 229 7e-75 gb|PKY26364.1| hypothetical protein RhiirB3_415080 [Rhizophagus ... 228 1e-74 dbj|GBC21305.1| putative Large subunit ribosomal protein L41 [Rh... 159 2e-47 gb|ORX92721.1| hypothetical protein K493DRAFT_263152 [Basidiobol... 109 5e-28 gb|ORY92121.1| mitochondrial ribosomal protein L27-domain-contai... 99 7e-24 emb|CDS02906.1| hypothetical protein LRAMOSA00308 [Lichtheimia r... 97 3e-23 emb|CEI86840.1| Putative 50s ribosomal protein 27 [Rhizopus micr... 96 7e-23 gb|ORX61584.1| hypothetical protein DM01DRAFT_1404357 [Hesseltin... 96 1e-22 ref|XP_023467290.1| hypothetical protein RHIMIDRAFT_236635 [Rhiz... 96 1e-22 gb|ORZ17115.1| mitochondrial ribosomal protein L27-domain-contai... 94 7e-22 gb|KXN71505.1| hypothetical protein CONCODRAFT_5757 [Conidiobolu... 94 7e-22 gb|ORX82492.1| hypothetical protein K493DRAFT_361433 [Basidiobol... 93 3e-21 gb|ORZ07672.1| mitochondrial ribosomal protein L27-domain-contai... 92 3e-21 gb|EIE75854.1| hypothetical protein RO3G_00558 [Rhizopus delemar... 92 3e-21 gb|OAQ32790.1| hypothetical protein K457DRAFT_134898 [Mortierell... 92 4e-21 gb|OZJ02294.1| hypothetical protein BZG36_05347 [Bifiguratus ade... 91 1e-20 emb|CEP16708.1| hypothetical protein [Parasitella parasitica] 90 2e-20 emb|CDH53687.1| predicted protein [Lichtheimia corymbifera JMRC:... 97 5e-20 gb|OBZ89676.1| 54S ribosomal protein L27, mitochondrial [Choanep... 89 5e-20 gb|KFH62975.1| hypothetical protein MVEG_11013 [Mortierella vert... 89 6e-20 >gb|EXX67633.1| hypothetical protein RirG_112540 [Rhizophagus irregularis DAOM 197198w] gb|PKC13798.1| hypothetical protein RhiirA5_351159 [Rhizophagus irregularis] gb|PKC69412.1| hypothetical protein RhiirA1_415692 [Rhizophagus irregularis] gb|PKK66531.1| hypothetical protein RhiirC2_753296 [Rhizophagus irregularis] gb|PKY51706.1| hypothetical protein RhiirA4_407646 [Rhizophagus irregularis] gb|POG64224.1| mitochondrial ribosomal protein L27-domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 109 Score = 229 bits (583), Expect = 7e-75 Identities = 108/109 (99%), Positives = 109/109 (100%) Frame = +2 Query: 59 MTFGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLT 238 MTFGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLT Sbjct: 1 MTFGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLT 60 Query: 239 DCPYLPYVEPKAKRGIKYTIDTDKYLELANKYVKKISENKLMIANEAKS 385 DCPYLPYVEPKAKRGIKYTIDTDKYLELANKYVKKISENKLMIANEAK+ Sbjct: 61 DCPYLPYVEPKAKRGIKYTIDTDKYLELANKYVKKISENKLMIANEAKN 109 >gb|PKY26364.1| hypothetical protein RhiirB3_415080 [Rhizophagus irregularis] Length = 109 Score = 228 bits (582), Expect = 1e-74 Identities = 107/109 (98%), Positives = 109/109 (100%) Frame = +2 Query: 59 MTFGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLT 238 MTFGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLT Sbjct: 1 MTFGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLT 60 Query: 239 DCPYLPYVEPKAKRGIKYTIDTDKYLELANKYVKKISENKLMIANEAKS 385 DCPYLPYVEPKAKRGIKYTIDTDKYLELANKYVKK+SENKLMIANEAK+ Sbjct: 61 DCPYLPYVEPKAKRGIKYTIDTDKYLELANKYVKKVSENKLMIANEAKN 109 >dbj|GBC21305.1| putative Large subunit ribosomal protein L41 [Rhizophagus irregularis DAOM 181602] Length = 107 Score = 159 bits (403), Expect = 2e-47 Identities = 84/140 (60%), Positives = 86/140 (61%) Frame = +2 Query: 110 MNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDCPYLPYVEPKAKRGIK 289 MNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDCPYLPYVEPKAKRGIK Sbjct: 1 MNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDCPYLPYVEPKAKRGIK 60 Query: 290 YTIDTDKYLELANKYVKKISENKLMIANEAKS*CLEKLFL*Y*RN**KNFC**TRELRDY 469 YTIDTDKYL++ Y Sbjct: 61 YTIDTDKYLDVIIPYQ-------------------------------------------- 76 Query: 470 SLSNSITAFNLIYECFVLVI 529 TAFNLIYECFVLVI Sbjct: 77 ------TAFNLIYECFVLVI 90 >gb|ORX92721.1| hypothetical protein K493DRAFT_263152 [Basidiobolus meristosporus CBS 931.73] Length = 90 Score = 109 bits (273), Expect = 5e-28 Identities = 53/87 (60%), Positives = 64/87 (73%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGV++AI RGA+R PM +KRGHNYYKG GSG+MG HTK GGY ID KVRTYVVP+LTDC Sbjct: 2 FGVVRAICRGARRDPMTSKRGHNYYKGKGSGAMGRHTKHGGYIIDYNKVRTYVVPDLTDC 61 Query: 245 PYLPYVEPKAKRGIKYTIDTDKYLELA 325 + PYV + ++ I TI +L A Sbjct: 62 QFKPYVSHRTEK-IATTISAKDFLSSA 87 >gb|ORY92121.1| mitochondrial ribosomal protein L27-domain-containing protein [Syncephalastrum racemosum] Length = 74 Score = 98.6 bits (244), Expect = 7e-24 Identities = 47/72 (65%), Positives = 56/72 (77%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVI+A+ RGAKR PM +KRGHNYYKGTGSG+MG HTK+G YKID +VRT+VVP+L Sbjct: 2 FGVIRALPRGAKRFPMTSKRGHNYYKGTGSGAMGRHTKKGNYKIDWNRVRTFVVPDLEGF 61 Query: 245 PYLPYVEPKAKR 280 PYV KA + Sbjct: 62 TLGPYVTRKADK 73 >emb|CDS02906.1| hypothetical protein LRAMOSA00308 [Lichtheimia ramosa] Length = 78 Score = 97.1 bits (240), Expect = 3e-23 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVI+AI RGA R P+ K+GHNYYKGTG+G+MG HTKRGGYK+D +VRTYVVP+L Sbjct: 2 FGVIRAIPRGASRLPLTAKKGHNYYKGTGTGAMGRHTKRGGYKVDWSRVRTYVVPDLEGF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 TLGPYVSRK 70 >emb|CEI86840.1| Putative 50s ribosomal protein 27 [Rhizopus microsporus] gb|ORE16871.1| hypothetical protein BCV71DRAFT_217426 [Rhizopus microsporus] Length = 81 Score = 96.3 bits (238), Expect = 7e-23 Identities = 46/69 (66%), Positives = 54/69 (78%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVIK+I RGA R P+ +KRGHNYYKGTGSG+MG HTK+GGY ID KVRT+VVP+L + Sbjct: 2 FGVIKSIPRGASRLPLTSKRGHNYYKGTGSGAMGRHTKKGGYIIDWNKVRTFVVPDLENF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 NLEPYVSRK 70 >gb|ORX61584.1| hypothetical protein DM01DRAFT_1404357 [Hesseltinella vesiculosa] Length = 77 Score = 95.5 bits (236), Expect = 1e-22 Identities = 43/69 (62%), Positives = 54/69 (78%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGV+KA+ R AKR P++ KRGHN+YKGTGSG+MG HTK+GGYK+D +VRT+VVP+L Sbjct: 2 FGVLKALPRSAKRLPLSAKRGHNHYKGTGSGAMGKHTKKGGYKVDWNRVRTFVVPDLEGF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 TLAPYVSRK 70 >ref|XP_023467290.1| hypothetical protein RHIMIDRAFT_236635 [Rhizopus microsporus ATCC 52813] emb|CEG76761.1| Putative Podospora anserina S mat genomic DNA chromosome 4, supercontig 4 [Rhizopus microsporus] emb|CEG65192.1| Putative Podospora anserina S mat genomic DNA chromosome 4, supercontig 4 [Rhizopus microsporus] emb|CEJ00835.1| Putative Podospora anserina S mat genomic DNA chromosome 4, supercontig 4 [Rhizopus microsporus] gb|ORE06559.1| hypothetical protein BCV72DRAFT_207114 [Rhizopus microsporus var. microsporus] gb|PHZ13582.1| hypothetical protein RHIMIDRAFT_236635 [Rhizopus microsporus ATCC 52813] Length = 81 Score = 95.5 bits (236), Expect = 1e-22 Identities = 45/69 (65%), Positives = 54/69 (78%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVIK+I RGA R P+ +KRGHNYYKGTGSG+MG HTK+GGY +D KVRT+VVP+L + Sbjct: 2 FGVIKSIPRGASRLPLTSKRGHNYYKGTGSGAMGRHTKKGGYIVDWNKVRTFVVPDLENF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 NLGPYVSRK 70 >gb|ORZ17115.1| mitochondrial ribosomal protein L27-domain-containing protein [Absidia repens] Length = 77 Score = 93.6 bits (231), Expect = 7e-22 Identities = 43/69 (62%), Positives = 52/69 (75%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGV+K+I RGAKR + K+GHN+YKGTGSG+MG HTK GGYK+D KVRT+VVP+L Sbjct: 2 FGVVKSIPRGAKRIQLTAKQGHNFYKGTGSGAMGRHTKNGGYKVDWNKVRTFVVPDLEGF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 SLAPYVSRK 70 >gb|KXN71505.1| hypothetical protein CONCODRAFT_5757 [Conidiobolus coronatus NRRL 28638] Length = 90 Score = 94.0 bits (232), Expect = 7e-22 Identities = 47/89 (52%), Positives = 59/89 (66%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVI+ +YRGA R PM KRGH YYKGTG+GS G H +GGY I+ +KVR YVVPNL +C Sbjct: 2 FGVIRNLYRGAVREPMIRKRGHQYYKGTGTGSHGRHNGKGGYIIESQKVRHYVVPNLENC 61 Query: 245 PYLPYVEPKAKRGIKYTIDTDKYLELANK 331 PYV ++ + K D +LE A + Sbjct: 62 ELTPYVSHRSPKVYKTCTQKD-FLEAAKE 89 >gb|ORX82492.1| hypothetical protein K493DRAFT_361433 [Basidiobolus meristosporus CBS 931.73] Length = 98 Score = 92.8 bits (229), Expect = 3e-21 Identities = 45/82 (54%), Positives = 56/82 (68%), Gaps = 8/82 (9%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYK--------GTGSGSMGWHTKRGGYKIDPKKVRTY 220 FGV++AI RGA+R PM +KRGH + G GSG+MG HTK GGY ID KVRTY Sbjct: 2 FGVVRAICRGARRDPMTSKRGHKLLQSVLIERIVGKGSGAMGRHTKHGGYIIDYNKVRTY 61 Query: 221 VVPNLTDCPYLPYVEPKAKRGI 286 VVP+LTDC + PYV + +R + Sbjct: 62 VVPDLTDCQFKPYVSHRTRRSL 83 >gb|ORZ07672.1| mitochondrial ribosomal protein L27-domain-containing protein [Absidia repens] Length = 77 Score = 92.0 bits (227), Expect = 3e-21 Identities = 42/69 (60%), Positives = 52/69 (75%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGV+K+I RGAKR + K+GH++YKGTGSG+MG HTK GGYK+D KVRT+VVP+L Sbjct: 2 FGVVKSISRGAKRIQLTAKQGHHFYKGTGSGAMGRHTKNGGYKVDWNKVRTFVVPDLEGF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 SLAPYVSRK 70 >gb|EIE75854.1| hypothetical protein RO3G_00558 [Rhizopus delemar RA 99-880] Length = 81 Score = 92.0 bits (227), Expect = 3e-21 Identities = 44/69 (63%), Positives = 53/69 (76%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVI++I RGA R + +KRGHNYYKGTGSG+MG HTK+GGY ID KVRT+VVP+L + Sbjct: 2 FGVIRSIPRGASRLQLTSKRGHNYYKGTGSGAMGRHTKKGGYVIDWNKVRTFVVPDLENF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 NLGPYVSRK 70 >gb|OAQ32790.1| hypothetical protein K457DRAFT_134898 [Mortierella elongata AG-77] Length = 97 Score = 92.4 bits (228), Expect = 4e-21 Identities = 43/72 (59%), Positives = 54/72 (75%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FG+ KAI RGA R + +KRG N+YKGTGSG+MG HTKRGGY I+ +KVR +VVP+LTD Sbjct: 2 FGITKAIMRGASRQQLTSKRGRNHYKGTGSGAMGRHTKRGGYFIEWEKVRAFVVPDLTDF 61 Query: 245 PYLPYVEPKAKR 280 LPYV ++ Sbjct: 62 KLLPYVSRSTQK 73 >gb|OZJ02294.1| hypothetical protein BZG36_05347 [Bifiguratus adelaidae] Length = 91 Score = 90.9 bits (224), Expect = 1e-20 Identities = 43/70 (61%), Positives = 53/70 (75%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FG+++ I RGA R P+ +KRGHN+YKGT SG+MG HTKRGGY ID +KVRT+VVP+L Sbjct: 2 FGIVRNIPRGAGRFPLTSKRGHNFYKGTRSGAMGRHTKRGGYMIDWEKVRTFVVPDLEGF 61 Query: 245 PYLPYVEPKA 274 PYV KA Sbjct: 62 KLHPYVSRKA 71 >emb|CEP16708.1| hypothetical protein [Parasitella parasitica] Length = 81 Score = 90.1 bits (222), Expect = 2e-20 Identities = 43/69 (62%), Positives = 50/69 (72%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVIK+I RGA R + K+GHNYYKGTGSG+MG HTK GGY +D KVRT+VVP+L Sbjct: 2 FGVIKSIPRGASRLQLTAKKGHNYYKGTGSGAMGRHTKNGGYLVDWNKVRTFVVPDLEGF 61 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 62 TLGPYVSRK 70 >emb|CDH53687.1| predicted protein [Lichtheimia corymbifera JMRC:FSU:9682] Length = 995 Score = 97.1 bits (240), Expect = 5e-20 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGVI+AI RGA R P+ K+GHNYYKGTG+G+MG HTKRGGYK+D +VRTYVVP+L Sbjct: 919 FGVIRAIPRGASRLPLTAKKGHNYYKGTGTGAMGRHTKRGGYKVDWNRVRTYVVPDLEGF 978 Query: 245 PYLPYVEPK 271 PYV K Sbjct: 979 TLGPYVSRK 987 >gb|OBZ89676.1| 54S ribosomal protein L27, mitochondrial [Choanephora cucurbitarum] Length = 81 Score = 89.0 bits (219), Expect = 5e-20 Identities = 42/70 (60%), Positives = 51/70 (72%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FGV+K+I RGA R + K+GHNYYKGT SG+MG HTK GGY +D KVRT+VVP+L + Sbjct: 2 FGVVKSIPRGASRLQLTAKKGHNYYKGTRSGAMGRHTKNGGYLVDWNKVRTFVVPDLENF 61 Query: 245 PYLPYVEPKA 274 PYV KA Sbjct: 62 SLGPYVSRKA 71 >gb|KFH62975.1| hypothetical protein MVEG_11013 [Mortierella verticillata NRRL 6337] Length = 97 Score = 89.4 bits (220), Expect = 6e-20 Identities = 40/72 (55%), Positives = 54/72 (75%) Frame = +2 Query: 65 FGVIKAIYRGAKRTPMNTKRGHNYYKGTGSGSMGWHTKRGGYKIDPKKVRTYVVPNLTDC 244 FG+ + + RGA R + +KRG N+YKGTGSG+MG HTKRGGY I+ +KVR++VVP+LTD Sbjct: 2 FGITRCLTRGASRQQLTSKRGRNHYKGTGSGAMGRHTKRGGYLIEWEKVRSFVVPDLTDF 61 Query: 245 PYLPYVEPKAKR 280 LPYV ++ Sbjct: 62 KLLPYVSRSTQK 73