BLASTX nr result
ID: Ophiopogon26_contig00045425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00045425 (574 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC05781.1| hypothetical protein RhiirA5_420461 [Rhizophagus ... 71 3e-16 gb|PKY49046.1| hypothetical protein RhiirA4_464856 [Rhizophagus ... 71 3e-16 gb|PKY34253.1| hypothetical protein RhiirB3_453794 [Rhizophagus ... 73 3e-16 gb|PKC54931.1| hypothetical protein RhiirA1_504966 [Rhizophagus ... 73 3e-16 gb|PKB96073.1| hypothetical protein RhiirA5_435508 [Rhizophagus ... 73 3e-16 gb|PKB94631.1| hypothetical protein RhiirA5_438350, partial [Rhi... 73 3e-16 dbj|GBC16478.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 73 3e-16 dbj|GBC16414.1| hypothetical protein RIR_0457400 [Rhizophagus ir... 73 3e-16 gb|PKY53706.1| hypothetical protein RhiirA4_472068 [Rhizophagus ... 73 3e-16 gb|PKY32664.1| hypothetical protein RhiirB3_492587 [Rhizophagus ... 73 3e-16 gb|PKK75292.1| hypothetical protein RhiirC2_773787 [Rhizophagus ... 71 2e-15 gb|PKY15407.1| hypothetical protein RhiirB3_427609 [Rhizophagus ... 65 1e-14 gb|PKK78885.1| hypothetical protein RhiirC2_705484 [Rhizophagus ... 65 4e-14 gb|PKC72517.1| hypothetical protein RhiirA1_452212 [Rhizophagus ... 65 1e-13 dbj|GBC16507.1| hypothetical protein RIR_0463700 [Rhizophagus ir... 65 1e-13 gb|PKC13515.1| hypothetical protein RhiirA5_458900, partial [Rhi... 65 1e-13 gb|EXX53046.1| hypothetical protein RirG_247700 [Rhizophagus irr... 57 5e-12 gb|PKC60342.1| hypothetical protein RhiirA1_21715 [Rhizophagus i... 60 1e-08 >gb|PKC05781.1| hypothetical protein RhiirA5_420461 [Rhizophagus irregularis] gb|PKC71605.1| hypothetical protein RhiirA1_453337 [Rhizophagus irregularis] gb|PKY13983.1| hypothetical protein RhiirB3_425901 [Rhizophagus irregularis] gb|POG69296.1| hypothetical protein GLOIN_2v1777252 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 275 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITP WI DMVQLFIEED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPCWIKDMVQLFIEED 122 Score = 42.0 bits (97), Expect(2) = 3e-16 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFLPIESENLLIK Sbjct: 61 IKLYKVIANFLPIESENLLIK 81 >gb|PKY49046.1| hypothetical protein RhiirA4_464856 [Rhizophagus irregularis] Length = 273 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITP WI DMVQLFIEED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPCWIKDMVQLFIEED 122 Score = 42.0 bits (97), Expect(2) = 3e-16 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFLPIESENLLIK Sbjct: 61 IKLYKVIANFLPIESENLLIK 81 >gb|PKY34253.1| hypothetical protein RhiirB3_453794 [Rhizophagus irregularis] Length = 478 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPYWIRDMVQLFIKED 122 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 61 VKLYKVIANFLPIESENLLI 80 >gb|PKC54931.1| hypothetical protein RhiirA1_504966 [Rhizophagus irregularis] Length = 478 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPYWIRDMVQLFIKED 122 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 61 VKLYKVIANFLPIESENLLI 80 >gb|PKB96073.1| hypothetical protein RhiirA5_435508 [Rhizophagus irregularis] gb|PKB96865.1| hypothetical protein RhiirA5_434103 [Rhizophagus irregularis] Length = 478 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPYWIRDMVQLFIKED 122 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 61 VKLYKVIANFLPIESENLLI 80 >gb|PKB94631.1| hypothetical protein RhiirA5_438350, partial [Rhizophagus irregularis] gb|PKB95167.1| hypothetical protein RhiirA5_437240, partial [Rhizophagus irregularis] gb|PKB95170.1| hypothetical protein RhiirA5_437233, partial [Rhizophagus irregularis] Length = 474 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPYWIRDMVQLFIKED 122 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 61 VKLYKVIANFLPIESENLLI 80 >dbj|GBC16478.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 468 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 78 SYKLPRKPTFEYMNYFTQITPYWIRDMVQLFIKED 112 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 51 VKLYKVIANFLPIESENLLI 70 >dbj|GBC16414.1| hypothetical protein RIR_0457400 [Rhizophagus irregularis DAOM 181602] Length = 468 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 78 SYKLPRKPTFEYMNYFTQITPYWIRDMVQLFIKED 112 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 51 VKLYKVIANFLPIESENLLI 70 >gb|PKY53706.1| hypothetical protein RhiirA4_472068 [Rhizophagus irregularis] Length = 466 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 76 SYKLPRKPTFEYMNYFTQITPYWIKDMVQLFIKED 110 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 49 VKLYKVIANFLPIESENLLI 68 >gb|PKY32664.1| hypothetical protein RhiirB3_492587 [Rhizophagus irregularis] Length = 451 Score = 72.8 bits (177), Expect(2) = 3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITPYWI DMVQLFI+ED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPYWIRDMVQLFIKED 122 Score = 39.7 bits (91), Expect(2) = 3e-16 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLI 130 ++LYKVIANFLPIESENLLI Sbjct: 61 VKLYKVIANFLPIESENLLI 80 >gb|PKK75292.1| hypothetical protein RhiirC2_773787 [Rhizophagus irregularis] Length = 275 Score = 70.9 bits (172), Expect(2) = 2e-15 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTFEYMNYFTQITP WI DMVQLFIEED Sbjct: 88 SYKLPRKPTFEYMNYFTQITPCWIKDMVQLFIEED 122 Score = 39.3 bits (90), Expect(2) = 2e-15 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LY +IANFLPIESENLLIK Sbjct: 61 IKLYTIIANFLPIESENLLIK 81 >gb|PKY15407.1| hypothetical protein RhiirB3_427609 [Rhizophagus irregularis] Length = 476 Score = 65.1 bits (157), Expect(2) = 1e-14 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTF+YMN FTQIT +WI DMVQLFIEED Sbjct: 87 SYKLPRKPTFDYMNCFTQITTFWIKDMVQLFIEED 121 Score = 42.0 bits (97), Expect(2) = 1e-14 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFLPIESENLLIK Sbjct: 60 IKLYKVIANFLPIESENLLIK 80 >gb|PKK78885.1| hypothetical protein RhiirC2_705484 [Rhizophagus irregularis] Length = 476 Score = 65.1 bits (157), Expect(2) = 4e-14 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTF+YMN FTQIT +WI DMVQLFIEED Sbjct: 87 SYKLPRKPTFDYMNCFTQITTFWIKDMVQLFIEED 121 Score = 40.4 bits (93), Expect(2) = 4e-14 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFLPIESEN LIK Sbjct: 60 IKLYKVIANFLPIESENFLIK 80 >gb|PKC72517.1| hypothetical protein RhiirA1_452212 [Rhizophagus irregularis] Length = 476 Score = 65.1 bits (157), Expect(2) = 1e-13 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTF+YMN FTQIT +WI DMVQLFIEED Sbjct: 87 SYKLPRKPTFDYMNCFTQITTFWIKDMVQLFIEED 121 Score = 38.9 bits (89), Expect(2) = 1e-13 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFL IESENLLIK Sbjct: 60 IKLYKVIANFLSIESENLLIK 80 >dbj|GBC16507.1| hypothetical protein RIR_0463700 [Rhizophagus irregularis DAOM 181602] gb|POG73640.1| hypothetical protein GLOIN_2v1827418 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 476 Score = 65.1 bits (157), Expect(2) = 1e-13 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTF+YMN FTQIT +WI DMVQLFIEED Sbjct: 87 SYKLPRKPTFDYMNCFTQITTFWIKDMVQLFIEED 121 Score = 38.9 bits (89), Expect(2) = 1e-13 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFL IESENLLIK Sbjct: 60 IKLYKVIANFLSIESENLLIK 80 >gb|PKC13515.1| hypothetical protein RhiirA5_458900, partial [Rhizophagus irregularis] Length = 464 Score = 65.1 bits (157), Expect(2) = 1e-13 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLFIEED 14 S+KLPRKPTF+YMN FTQIT +WI DMVQLFIEED Sbjct: 87 SYKLPRKPTFDYMNCFTQITTFWIKDMVQLFIEED 121 Score = 38.9 bits (89), Expect(2) = 1e-13 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFL IESENLLIK Sbjct: 60 IKLYKVIANFLSIESENLLIK 80 >gb|EXX53046.1| hypothetical protein RirG_247700 [Rhizophagus irregularis DAOM 197198w] Length = 120 Score = 56.6 bits (135), Expect(2) = 5e-12 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 118 SHKLPRKPTFEYMNYFTQITPYWIIDMVQLF 26 S+KLPRKPTFEYMNYFTQITP WI DM F Sbjct: 88 SYKLPRKPTFEYMNYFTQITPCWIKDMKSKF 118 Score = 42.0 bits (97), Expect(2) = 5e-12 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 189 IQLYKVIANFLPIESENLLIK 127 I+LYKVIANFLPIESENLLIK Sbjct: 61 IKLYKVIANFLPIESENLLIK 81 >gb|PKC60342.1| hypothetical protein RhiirA1_21715 [Rhizophagus irregularis] Length = 100 Score = 60.1 bits (144), Expect = 1e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 11 IIFFNKKLHHIYNPIWRDLSKIIHVF 88 IIFFNKKLHH+YNPIWRDLSKIIHVF Sbjct: 8 IIFFNKKLHHVYNPIWRDLSKIIHVF 33