BLASTX nr result
ID: Ophiopogon26_contig00045317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00045317 (1168 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX77540.1| hypothetical protein RirG_022930 [Rhizophagus irr... 65 2e-09 >gb|EXX77540.1| hypothetical protein RirG_022930 [Rhizophagus irregularis DAOM 197198w] Length = 92 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -1 Query: 655 IVFAKSFGDRQDEHLLYKICLEKLRLNPQLLKSCNGELVEKLVSNCISSFEVWI 494 IV+ +SFG +++EH YKICLEKL +P L+ S + E V+K+ S C+ SFE WI Sbjct: 35 IVYIESFGKKEEEHRTYKICLEKLVESPHLINSHDSETVQKMASQCLESFEFWI 88