BLASTX nr result
ID: Ophiopogon26_contig00045272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00045272 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CFW92990.1| protein of unknown function [endosymbiont DhMRE ... 63 1e-09 >emb|CFW92990.1| protein of unknown function [endosymbiont DhMRE of Dentiscutata heterogama] Length = 146 Score = 63.2 bits (152), Expect = 1e-09 Identities = 37/63 (58%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = -1 Query: 452 EKVSSEQLSEGRSYGGRPRK*KSEAEREIFERQQK---KECVLRVYRSYGEVQIKGCLVC 282 EKVSS +LSE GGRPRK +EAER+ + RQQK + LR YRSYGEVQIK C Sbjct: 18 EKVSSRKLSEWGRLGGRPRKWTNEAERKKWMRQQKALSEGRELRAYRSYGEVQIKSFGKC 77 Query: 281 PNC 273 NC Sbjct: 78 SNC 80