BLASTX nr result
ID: Ophiopogon26_contig00045252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00045252 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX69306.1| hypothetical protein RirG_097310 [Rhizophagus irr... 57 5e-07 >gb|EXX69306.1| hypothetical protein RirG_097310 [Rhizophagus irregularis DAOM 197198w] gb|ANQ32695.1| MATA-HMG [Rhizophagus irregularis] gb|ANQ32696.1| MATA-HMG [Rhizophagus irregularis] gb|ANQ32697.1| MATA-HMG [Rhizophagus irregularis] gb|ANQ32698.1| MATA-HMG [Rhizophagus irregularis] gb|ANQ32699.1| MATA-HMG [Rhizophagus irregularis] dbj|GBC19607.1| hypothetical protein RIR_0712600 [Rhizophagus irregularis DAOM 181602] gb|PKC10719.1| hypothetical protein RhiirA5_414008 [Rhizophagus irregularis] gb|PKC65942.1| hypothetical protein RhiirA1_441994 [Rhizophagus irregularis] gb|PKK77423.1| hypothetical protein RhiirC2_706606 [Rhizophagus irregularis] gb|PKY22115.1| hypothetical protein RhiirB3_386180 [Rhizophagus irregularis] gb|PKY41029.1| hypothetical protein RhiirA4_454526 [Rhizophagus irregularis] gb|POG76166.1| hypothetical protein GLOIN_2v1769419 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 130 Score = 56.6 bits (135), Expect = 5e-07 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = +1 Query: 385 LVPSSNRTPLNSFMLYRKDRSSVITNRLGENSKTL 489 L PSSNRTP NSFMLY KD SSVI NR GENSKTL Sbjct: 36 LKPSSNRTPPNSFMLYCKDHSSVIINRPGENSKTL 70