BLASTX nr result
ID: Ophiopogon26_contig00045199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00045199 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG76518.1| hypothetical protein GLOIN_2v1555119, partial [Rh... 126 5e-33 gb|EXX55849.1| hypothetical protein RirG_221560 [Rhizophagus irr... 126 1e-32 gb|EXX55848.1| hypothetical protein RirG_221560 [Rhizophagus irr... 126 3e-32 >gb|POG76518.1| hypothetical protein GLOIN_2v1555119, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 246 Score = 126 bits (316), Expect = 5e-33 Identities = 68/99 (68%), Positives = 79/99 (79%), Gaps = 5/99 (5%) Frame = -1 Query: 284 KYDISALIISFVTFCALSTFCGILFAVNFTGWFIVTVVGGGITKFRQELFKS-----FKP 120 KYDIS LIISF+TFCALSTFCGI+F VNFTGWF++TV+GG I K RQEL KS FKP Sbjct: 22 KYDISVLIISFITFCALSTFCGIIFTVNFTGWFVITVIGGFIAKCRQELIKSLSGKKFKP 81 Query: 119 GKKSGIEMLDHRLNSSRHFNHFEDFRLTSPKDCLPSIPS 3 K+ + MLDHRLN SRH HFE+FRL+S K+ +PSIPS Sbjct: 82 EKE--VNMLDHRLN-SRH--HFEEFRLSSSKE-IPSIPS 114 >gb|EXX55849.1| hypothetical protein RirG_221560 [Rhizophagus irregularis DAOM 197198w] Length = 294 Score = 126 bits (316), Expect = 1e-32 Identities = 68/99 (68%), Positives = 79/99 (79%), Gaps = 5/99 (5%) Frame = -1 Query: 284 KYDISALIISFVTFCALSTFCGILFAVNFTGWFIVTVVGGGITKFRQELFKS-----FKP 120 KYDIS LIISF+TFCALSTFCGI+F VNFTGWF++TV+GG I K RQEL KS FKP Sbjct: 22 KYDISVLIISFITFCALSTFCGIIFTVNFTGWFVITVIGGFIAKCRQELIKSLSGKKFKP 81 Query: 119 GKKSGIEMLDHRLNSSRHFNHFEDFRLTSPKDCLPSIPS 3 K+ + MLDHRLN SRH HFE+FRL+S K+ +PSIPS Sbjct: 82 EKE--VNMLDHRLN-SRH--HFEEFRLSSSKE-IPSIPS 114 >gb|EXX55848.1| hypothetical protein RirG_221560 [Rhizophagus irregularis DAOM 197198w] dbj|GBC30195.1| hypothetical protein RIR_1576900 [Rhizophagus irregularis DAOM 181602] Length = 329 Score = 126 bits (316), Expect = 3e-32 Identities = 68/99 (68%), Positives = 79/99 (79%), Gaps = 5/99 (5%) Frame = -1 Query: 284 KYDISALIISFVTFCALSTFCGILFAVNFTGWFIVTVVGGGITKFRQELFKS-----FKP 120 KYDIS LIISF+TFCALSTFCGI+F VNFTGWF++TV+GG I K RQEL KS FKP Sbjct: 22 KYDISVLIISFITFCALSTFCGIIFTVNFTGWFVITVIGGFIAKCRQELIKSLSGKKFKP 81 Query: 119 GKKSGIEMLDHRLNSSRHFNHFEDFRLTSPKDCLPSIPS 3 K+ + MLDHRLN SRH HFE+FRL+S K+ +PSIPS Sbjct: 82 EKE--VNMLDHRLN-SRH--HFEEFRLSSSKE-IPSIPS 114