BLASTX nr result
ID: Ophiopogon26_contig00044703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00044703 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC19989.1| cyclin binding protein [Rhizophagus irregularis ... 71 5e-11 gb|PKK73492.1| hypothetical protein RhiirC2_740685 [Rhizophagus ... 71 5e-11 gb|PKC65655.1| hypothetical protein RhiirA1_536176 [Rhizophagus ... 71 5e-11 gb|EXX79811.1| Rod1p [Rhizophagus irregularis DAOM 197198w] >gi|... 71 5e-11 gb|PKY48871.1| hypothetical protein RhiirA4_445576 [Rhizophagus ... 71 5e-11 >dbj|GBC19989.1| cyclin binding protein [Rhizophagus irregularis DAOM 181602] Length = 411 Score = 70.9 bits (172), Expect = 5e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 143 DILPIYYESENDNDSIISTTSWDELSFDDVSLPP 42 DILP+YYESENDNDSIIST SWDE+SFDDVSLPP Sbjct: 357 DILPLYYESENDNDSIISTASWDEISFDDVSLPP 390 >gb|PKK73492.1| hypothetical protein RhiirC2_740685 [Rhizophagus irregularis] Length = 456 Score = 70.9 bits (172), Expect = 5e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 143 DILPIYYESENDNDSIISTTSWDELSFDDVSLPP 42 DILP+YYESENDNDSIIST SWDE+SFDDVSLPP Sbjct: 402 DILPLYYESENDNDSIISTASWDEISFDDVSLPP 435 >gb|PKC65655.1| hypothetical protein RhiirA1_536176 [Rhizophagus irregularis] Length = 456 Score = 70.9 bits (172), Expect = 5e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 143 DILPIYYESENDNDSIISTTSWDELSFDDVSLPP 42 DILP+YYESENDNDSIIST SWDE+SFDDVSLPP Sbjct: 402 DILPLYYESENDNDSIISTASWDEISFDDVSLPP 435 >gb|EXX79811.1| Rod1p [Rhizophagus irregularis DAOM 197198w] gb|PKC16707.1| hypothetical protein RhiirA5_493562 [Rhizophagus irregularis] gb|PKY12886.1| hypothetical protein RhiirB3_518377 [Rhizophagus irregularis] gb|POG65360.1| hypothetical protein GLOIN_2v1667393 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 456 Score = 70.9 bits (172), Expect = 5e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 143 DILPIYYESENDNDSIISTTSWDELSFDDVSLPP 42 DILP+YYESENDNDSIIST SWDE+SFDDVSLPP Sbjct: 402 DILPLYYESENDNDSIISTASWDEISFDDVSLPP 435 >gb|PKY48871.1| hypothetical protein RhiirA4_445576 [Rhizophagus irregularis] Length = 457 Score = 70.9 bits (172), Expect = 5e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 143 DILPIYYESENDNDSIISTTSWDELSFDDVSLPP 42 DILP+YYESENDNDSIIST SWDE+SFDDVSLPP Sbjct: 403 DILPLYYESENDNDSIISTASWDEISFDDVSLPP 436