BLASTX nr result
ID: Ophiopogon26_contig00044528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00044528 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC35488.1| hypothetical protein RIR_2005500 [Rhizophagus ir... 86 2e-19 >dbj|GBC35488.1| hypothetical protein RIR_2005500 [Rhizophagus irregularis DAOM 181602] gb|PKB98422.1| hypothetical protein RhiirA5_506184 [Rhizophagus irregularis] gb|PKK60969.1| hypothetical protein RhiirC2_856543 [Rhizophagus irregularis] gb|POG60484.1| hypothetical protein GLOIN_2v1712813 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 73 Score = 85.9 bits (211), Expect = 2e-19 Identities = 42/73 (57%), Positives = 46/73 (63%) Frame = -1 Query: 313 MQFSKVSXXXXXXXXXXIVNAVPSNDLQKRISCGFGDAGCKAXXXXXXXXXXXXXXXNTC 134 MQFSKVS IVNA+PSNDLQKRISC FGDAGCKA ++C Sbjct: 1 MQFSKVSFFLFLFTIITIVNAIPSNDLQKRISCSFGDAGCKASCFSKNGCCCNTCNGSSC 60 Query: 133 KEICDCQCSCFKK 95 K+ICDC CSCFKK Sbjct: 61 KDICDCSCSCFKK 73