BLASTX nr result
ID: Ophiopogon26_contig00044418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00044418 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKB95099.1| hypothetical protein RhiirA5_437377 [Rhizophagus ... 55 3e-06 gb|PKY30825.1| hypothetical protein RhiirB3_448116 [Rhizophagus ... 53 9e-06 >gb|PKB95099.1| hypothetical protein RhiirA5_437377 [Rhizophagus irregularis] Length = 208 Score = 55.1 bits (131), Expect = 3e-06 Identities = 36/75 (48%), Positives = 40/75 (53%), Gaps = 25/75 (33%) Frame = +2 Query: 197 FQDKPGGLPKNGKTKDSFGWISDEWK-----------------TKIRSGGLPSSEER--- 316 F+ + GGLPKNGK KDSFG S+E K +KIRSGGLP SEER Sbjct: 55 FKIRSGGLPKNGKPKDSFGRASEERKPKDSQSDGLPYSEERENSKIRSGGLPYSEERENS 114 Query: 317 -----KKPRFVAGFG 346 KKPRFV G Sbjct: 115 KDSKTKKPRFVRSGG 129 >gb|PKY30825.1| hypothetical protein RhiirB3_448116 [Rhizophagus irregularis] Length = 145 Score = 52.8 bits (125), Expect = 9e-06 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = +2 Query: 212 GGLPKNGKTKDSFGWISDEWKTK-IRSGGLPSSEERKKPRF 331 GGLPKNGK KDSF +S+E K K RS LP EERKKPRF Sbjct: 8 GGLPKNGKPKDSFKRVSEEQKPKDSRSSRLPCFEERKKPRF 48