BLASTX nr result
ID: Ophiopogon26_contig00044179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00044179 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC27485.1| rni-like protein [Rhizophagus irregularis DAOM 1... 75 2e-13 >dbj|GBC27485.1| rni-like protein [Rhizophagus irregularis DAOM 181602] gb|PKC17567.1| hypothetical protein RhiirA5_346179 [Rhizophagus irregularis] gb|PKC67553.1| hypothetical protein RhiirA1_418025 [Rhizophagus irregularis] gb|PKK76442.1| hypothetical protein RhiirC2_734229 [Rhizophagus irregularis] gb|PKY26351.1| hypothetical protein RhiirB3_415073 [Rhizophagus irregularis] gb|PKY46045.1| hypothetical protein RhiirA4_402004 [Rhizophagus irregularis] Length = 442 Score = 75.5 bits (184), Expect = 2e-13 Identities = 39/60 (65%), Positives = 41/60 (68%) Frame = +1 Query: 184 MANGEKRLIPEDKMERKKGSKRRQTGTTAKDDIEIFQXXXXXXXXXXXXXXXXXXXEAPS 363 MANGEKRLIPED+MERKKGSKRRQTGTTAKDDIE+FQ EAPS Sbjct: 1 MANGEKRLIPEDRMERKKGSKRRQTGTTAKDDIELFQSPPSSPLLTPKSSHLTSSLEAPS 60