BLASTX nr result
ID: Ophiopogon26_contig00044168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00044168 (751 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY13711.1| hypothetical protein RhiirB3_465590 [Rhizophagus ... 69 9e-11 gb|EXX59836.1| Rox1p [Rhizophagus irregularis DAOM 197198w] >gi|... 69 2e-10 gb|PKY51150.1| hypothetical protein RhiirA4_446685 [Rhizophagus ... 69 2e-10 >gb|PKY13711.1| hypothetical protein RhiirB3_465590 [Rhizophagus irregularis] Length = 182 Score = 69.3 bits (168), Expect = 9e-11 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 36 YVNLPIDTRLIFKQKSETVKYFHEQNYPEYRYSP 137 +VNLPIDTRLIFKQ SETVKYFHE NYPEYRYSP Sbjct: 139 WVNLPIDTRLIFKQMSETVKYFHELNYPEYRYSP 172 >gb|EXX59836.1| Rox1p [Rhizophagus irregularis DAOM 197198w] dbj|GBC38664.1| JEMT01026166.1_cds_EXX59836.1_20190 [Rhizophagus irregularis DAOM 181602] gb|PKC03267.1| hypothetical protein RhiirA5_402010 [Rhizophagus irregularis] gb|PKC61515.1| hypothetical protein RhiirA1_539112 [Rhizophagus irregularis] gb|PKK74506.1| hypothetical protein RhiirC2_820890 [Rhizophagus irregularis] gb|POG65102.1| hypothetical protein GLOIN_2v1805285 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 215 Score = 69.3 bits (168), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 36 YVNLPIDTRLIFKQKSETVKYFHEQNYPEYRYSP 137 +VNLPIDTRLIFKQ SETVKYFHE NYPEYRYSP Sbjct: 90 WVNLPIDTRLIFKQMSETVKYFHELNYPEYRYSP 123 >gb|PKY51150.1| hypothetical protein RhiirA4_446685 [Rhizophagus irregularis] Length = 216 Score = 69.3 bits (168), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 36 YVNLPIDTRLIFKQKSETVKYFHEQNYPEYRYSP 137 +VNLPIDTRLIFKQ SETVKYFHE NYPEYRYSP Sbjct: 90 WVNLPIDTRLIFKQMSETVKYFHELNYPEYRYSP 123