BLASTX nr result
ID: Ophiopogon26_contig00044074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00044074 (609 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC25496.1| hypothetical protein RIR_1193600 [Rhizophagus ir... 73 2e-13 >dbj|GBC25496.1| hypothetical protein RIR_1193600 [Rhizophagus irregularis DAOM 181602] Length = 80 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 391 STKICLTAGIQVQDVRRVECFFLCTPFEIGCVIVGRNSI 275 STKICLTAGIQVQDVR VECFFLCTPFE GCVIV R+ + Sbjct: 20 STKICLTAGIQVQDVRHVECFFLCTPFEFGCVIVVRDQL 58