BLASTX nr result
ID: Ophiopogon26_contig00044026
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00044026 (610 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY51522.1| hypothetical protein RhiirA4_407502 [Rhizophagus ... 54 3e-06 gb|PKK66884.1| DUF1703-domain-containing protein [Rhizophagus ir... 58 3e-06 gb|EXX50798.1| hypothetical protein RirG_267330 [Rhizophagus irr... 53 6e-06 >gb|PKY51522.1| hypothetical protein RhiirA4_407502 [Rhizophagus irregularis] Length = 73 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 599 IKSINEKLITSIVKHEENVYEKVVVLIDPF 510 +KSINEKLITSI +HEENVYEKVVVLID + Sbjct: 18 VKSINEKLITSIAEHEENVYEKVVVLIDEY 47 >gb|PKK66884.1| DUF1703-domain-containing protein [Rhizophagus irregularis] Length = 558 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = -2 Query: 300 NNLEDMTISSDLSGAYGFTEDEVKKTLKSRLLERFSDLTEETLIDL*KKYDGYSWD 133 N L D+T+S LSGAYGF E++ T +S+ L +S+++ ET+ L +KY+GYSWD Sbjct: 368 NQLVDLTLSDKLSGAYGFANKEIETTFESKFLGEYSNVS-ETMNKLKEKYNGYSWD 422 >gb|EXX50798.1| hypothetical protein RirG_267330 [Rhizophagus irregularis DAOM 197198w] dbj|GBC35420.1| JEMT01029769.1_cds_EXX50798.1_29231 [Rhizophagus irregularis DAOM 181602] Length = 78 Score = 52.8 bits (125), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 599 IKSINEKLITSIVKHEENVYEKVVVLIDPF 510 +KSINEKLITSI +HEENVYEKVVVLID + Sbjct: 23 VKSINEKLITSISEHEENVYEKVVVLIDEY 52