BLASTX nr result
ID: Ophiopogon26_contig00043961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043961 (1006 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG75931.1| hypothetical protein GLOIN_2v929451 [Rhizophagus ... 61 4e-16 gb|EXX65386.1| hypothetical protein RirG_133810 [Rhizophagus irr... 54 5e-10 gb|EXX66844.1| hypothetical protein RirG_119930 [Rhizophagus irr... 50 3e-09 gb|PKK64620.1| hypothetical protein RhiirC2_854184 [Rhizophagus ... 64 6e-08 gb|PKY56817.1| hypothetical protein RhiirA4_508284 [Rhizophagus ... 49 1e-07 gb|PKY51000.1| hypothetical protein RhiirA4_531788 [Rhizophagus ... 64 1e-07 dbj|GBC26973.1| hypothetical protein RIR_1314700 [Rhizophagus ir... 46 3e-07 gb|EXX77432.1| hypothetical protein RirG_023800 [Rhizophagus irr... 46 3e-07 gb|PKB98109.1| hypothetical protein RhiirA5_506329 [Rhizophagus ... 45 7e-07 gb|POG63678.1| hypothetical protein GLOIN_2v1881959 [Rhizophagus... 42 3e-06 >gb|POG75931.1| hypothetical protein GLOIN_2v929451 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 152 Score = 61.2 bits (147), Expect(2) = 4e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 833 IPGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 IPGDIIYAWRKNK N +LLNKTVEKGTRP ID Sbjct: 79 IPGDIIYAWRKNKYNAHLLNKTVEKGTRPIID 110 Score = 53.1 bits (126), Expect(2) = 4e-16 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 930 VSDDELVPRPLVVERLKKIFQPNRN 1004 +SDDELVPRPLVVERLKKIFQPNRN Sbjct: 111 ISDDELVPRPLVVERLKKIFQPNRN 135 >gb|EXX65386.1| hypothetical protein RirG_133810 [Rhizophagus irregularis DAOM 197198w] dbj|GBC27457.1| hypothetical protein RIR_1355300 [Rhizophagus irregularis DAOM 181602] gb|POG57843.1| hypothetical protein GLOIN_2v1791210 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 476 Score = 54.3 bits (129), Expect(2) = 5e-10 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = +2 Query: 818 GILPIIPGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 G++ +I D++YAW +N+ N LLNKT+EKGTRPKID Sbjct: 85 GVISLISTDLLYAWYRNRHNERLLNKTIEKGTRPKID 121 Score = 39.3 bits (90), Expect(2) = 5e-10 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = +3 Query: 921 KLIVSDDELVPRPLVVERLKKIFQPN 998 K+ V DDE VPRPLVV RLK+I QP+ Sbjct: 119 KIDVLDDEFVPRPLVVNRLKQILQPD 144 >gb|EXX66844.1| hypothetical protein RirG_119930 [Rhizophagus irregularis DAOM 197198w] Length = 202 Score = 50.4 bits (119), Expect(2) = 3e-09 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 821 ILPIIPGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 +L + GD+I+AW ++ N NLLNKTVEKGT+PKID Sbjct: 47 LLFFVSGDVIFAWIRSLYNENLLNKTVEKGTQPKID 82 Score = 40.4 bits (93), Expect(2) = 3e-09 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +3 Query: 921 KLIVSDDELVPRPLVVERLKKIFQPNRN 1004 K+ +SDDE V RP V+ER KKI QP++N Sbjct: 80 KIDISDDEFVSRPQVIERFKKILQPHKN 107 >gb|PKK64620.1| hypothetical protein RhiirC2_854184 [Rhizophagus irregularis] Length = 266 Score = 63.9 bits (154), Expect = 6e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 836 PGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 PGDIIYAWRKNK N++LLNKTVEKGTRPKID Sbjct: 23 PGDIIYAWRKNKYNIHLLNKTVEKGTRPKID 53 >gb|PKY56817.1| hypothetical protein RhiirA4_508284 [Rhizophagus irregularis] Length = 472 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = +2 Query: 818 GILPIIPGDIIYAWRKNKCNVNLLNKTVEKGTRPKI 925 G +I GD+ YAW N N+NL NKT+EKGTRP + Sbjct: 83 GFTILISGDLFYAWYLNSYNINLFNKTIEKGTRPVV 118 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 13/26 (50%), Positives = 22/26 (84%) Frame = +3 Query: 924 LIVSDDELVPRPLVVERLKKIFQPNR 1001 +++ +DELVPRP+ +E+LKKI P++ Sbjct: 118 VVIGEDELVPRPVAIEQLKKILLPHK 143 >gb|PKY51000.1| hypothetical protein RhiirA4_531788 [Rhizophagus irregularis] Length = 354 Score = 63.5 bits (153), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 836 PGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 PGDIIYAWRKNK NV++LNKTVEKGTRPKID Sbjct: 23 PGDIIYAWRKNKYNVHILNKTVEKGTRPKID 53 >dbj|GBC26973.1| hypothetical protein RIR_1314700 [Rhizophagus irregularis DAOM 181602] Length = 434 Score = 46.2 bits (108), Expect(2) = 3e-07 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = +2 Query: 821 ILPIIPGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 +L + GD++YA ++ N NLLNKTVEKGT+PKID Sbjct: 47 LLFFVSGDVLYACCRSLYNENLLNKTVEKGTQPKID 82 Score = 38.1 bits (87), Expect(2) = 3e-07 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +3 Query: 921 KLIVSDDELVPRPLVVERLKKIFQPNRN 1004 K+ +S+DE V RP VVER+K+I QP++N Sbjct: 80 KIDISNDEFVSRPQVVERIKEILQPHKN 107 >gb|EXX77432.1| hypothetical protein RirG_023800 [Rhizophagus irregularis DAOM 197198w] Length = 433 Score = 46.2 bits (108), Expect(2) = 3e-07 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = +2 Query: 821 ILPIIPGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 +L + GD++YA ++ N NLLNKTVEKGT+PKID Sbjct: 47 LLFFVSGDVLYACCRSLYNENLLNKTVEKGTQPKID 82 Score = 38.1 bits (87), Expect(2) = 3e-07 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +3 Query: 921 KLIVSDDELVPRPLVVERLKKIFQPNRN 1004 K+ +S+DE V RP VVER+K+I QP++N Sbjct: 80 KIDISNDEFVSRPQVVERIKEILQPHKN 107 >gb|PKB98109.1| hypothetical protein RhiirA5_506329 [Rhizophagus irregularis] gb|PKC54769.1| hypothetical protein RhiirA1_542759 [Rhizophagus irregularis] gb|PKY27230.1| hypothetical protein RhiirB3_529076 [Rhizophagus irregularis] Length = 390 Score = 44.7 bits (104), Expect(2) = 7e-07 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = +2 Query: 824 LPIIPGDIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 L I+ D++YA ++ N NLLNKTVEKGT+PKID Sbjct: 4 LVIVERDVLYACCRSLYNENLLNKTVEKGTQPKID 38 Score = 38.1 bits (87), Expect(2) = 7e-07 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +3 Query: 921 KLIVSDDELVPRPLVVERLKKIFQPNRN 1004 K+ +S+DE V RP VVER+K+I QP++N Sbjct: 36 KIDISNDEFVSRPQVVERIKEILQPHKN 63 >gb|POG63678.1| hypothetical protein GLOIN_2v1881959 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 404 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = +2 Query: 842 DIIYAWRKNKCNVNLLNKTVEKGTRPKID 928 D++YA ++ N NLLNKTVEKGT+PKID Sbjct: 25 DVLYACCRSLYNENLLNKTVEKGTQPKID 53 Score = 38.1 bits (87), Expect(2) = 3e-06 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +3 Query: 921 KLIVSDDELVPRPLVVERLKKIFQPNRN 1004 K+ +S+DE V RP VVER+K+I QP++N Sbjct: 51 KIDISNDEFVSRPQVVERIKEILQPHKN 78