BLASTX nr result
ID: Ophiopogon26_contig00043919
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043919 (504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY48596.1| hypothetical protein RhiirA4_293990, partial [Rhi... 94 3e-21 gb|PKK74965.1| hypothetical protein RhiirC2_265883 [Rhizophagus ... 96 5e-20 gb|PKC69225.1| hypothetical protein RhiirA1_456253, partial [Rhi... 96 5e-20 gb|PKC11129.1| hypothetical protein RhiirA5_413498, partial [Rhi... 96 6e-20 dbj|GBC53184.1| titin-like [Rhizophagus irregularis DAOM 181602] 96 6e-20 gb|PKY12644.1| hypothetical protein RhiirB3_424343 [Rhizophagus ... 96 6e-20 gb|POG69018.1| hypothetical protein GLOIN_2v198109 [Rhizophagus ... 77 2e-13 >gb|PKY48596.1| hypothetical protein RhiirA4_293990, partial [Rhizophagus irregularis] Length = 151 Score = 94.0 bits (232), Expect = 3e-21 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQ ENPKDGGKAIKNPQLPGGD Sbjct: 39 APPTPGDDPKNQDPKALLPKDPQKENPKDGGKAIKNPQLPGGD 81 >gb|PKK74965.1| hypothetical protein RhiirC2_265883 [Rhizophagus irregularis] Length = 566 Score = 96.3 bits (238), Expect = 5e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 312 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 354 >gb|PKC69225.1| hypothetical protein RhiirA1_456253, partial [Rhizophagus irregularis] Length = 609 Score = 96.3 bits (238), Expect = 5e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 511 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 553 Score = 91.7 bits (226), Expect = 2e-18 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPG 497 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPG Sbjct: 569 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPG 609 >gb|PKC11129.1| hypothetical protein RhiirA5_413498, partial [Rhizophagus irregularis] Length = 673 Score = 96.3 bits (238), Expect = 6e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 140 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 182 Score = 96.3 bits (238), Expect = 6e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 198 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 240 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNE PKDGGKAIKNPQLPGGD Sbjct: 24 APPTPGDDPKNQDPKALLPKDPQNETPKDGGKAIKNPQLPGGD 66 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNE PKDGGKAIKNPQLPGGD Sbjct: 82 APPTPGDDPKNQDPKALLPKDPQNETPKDGGKAIKNPQLPGGD 124 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQ ENPKDGGKAIKNPQLPGGD Sbjct: 279 APPTPGDDPKNQDPKALLPKDPQKENPKDGGKAIKNPQLPGGD 321 >dbj|GBC53184.1| titin-like [Rhizophagus irregularis DAOM 181602] Length = 1021 Score = 96.3 bits (238), Expect = 6e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 488 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 530 Score = 96.3 bits (238), Expect = 6e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 546 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 588 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNE PKDGGKAIKNPQLPGGD Sbjct: 430 APPTPGDDPKNQDPKALLPKDPQNETPKDGGKAIKNPQLPGGD 472 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQ ENPKDGGKAIKNPQLPGGD Sbjct: 627 APPTPGDDPKNQDPKALLPKDPQKENPKDGGKAIKNPQLPGGD 669 >gb|PKY12644.1| hypothetical protein RhiirB3_424343 [Rhizophagus irregularis] Length = 1224 Score = 96.3 bits (238), Expect = 6e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 691 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 733 Score = 96.3 bits (238), Expect = 6e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNENPKDGGKAIKNPQLPGGD Sbjct: 749 APPTPGDDPKNQDPKALLPKDPQNENPKDGGKAIKNPQLPGGD 791 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNE PKDGGKAIKNPQLPGGD Sbjct: 575 APPTPGDDPKNQDPKALLPKDPQNETPKDGGKAIKNPQLPGGD 617 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQNE PKDGGKAIKNPQLPGGD Sbjct: 633 APPTPGDDPKNQDPKALLPKDPQNETPKDGGKAIKNPQLPGGD 675 Score = 94.0 bits (232), Expect = 4e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 375 APPTPGDDPKNQDPKALLPKNPQNENPKDGGKAIKNPQLPGGD 503 APPTPGDDPKNQDPKALLPK+PQ ENPKDGGKAIKNPQLPGGD Sbjct: 830 APPTPGDDPKNQDPKALLPKDPQKENPKDGGKAIKNPQLPGGD 872 >gb|POG69018.1| hypothetical protein GLOIN_2v198109 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 481 Score = 77.4 bits (189), Expect = 2e-13 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = +1 Query: 364 MEKRLHQHQEMIQKIKIQKHYYRRIRKMKTQRTGVKLSRILSYQEVI 504 MEK LHQHQEMIQKIKIQKH YRRIRK KTQR VK SRI SYQEVI Sbjct: 296 MEKMLHQHQEMIQKIKIQKHCYRRIRKKKTQRMEVKPSRIHSYQEVI 342