BLASTX nr result
ID: Ophiopogon26_contig00043651
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043651 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY61244.1| hypothetical protein RhiirA4_485945 [Rhizophagus ... 79 1e-15 >gb|PKY61244.1| hypothetical protein RhiirA4_485945 [Rhizophagus irregularis] Length = 157 Score = 78.6 bits (192), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 124 MEIPPTKILEKRIAIRKLNKKRFIINTLRKKVTEIRNYSNS 2 ME PPTKILEKRIAIRKL+KKRFIINTLRKKVTEIRNYSNS Sbjct: 1 METPPTKILEKRIAIRKLSKKRFIINTLRKKVTEIRNYSNS 41