BLASTX nr result
ID: Ophiopogon26_contig00043629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043629 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC42423.1| hypothetical protein RIR_2563100 [Rhizophagus ir... 88 7e-18 >dbj|GBC42423.1| hypothetical protein RIR_2563100 [Rhizophagus irregularis DAOM 181602] Length = 3227 Score = 88.2 bits (217), Expect = 7e-18 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 351 KNCDNIGNNCCDRCLLSVRTKYFGRLPDEEYAIFNMYLIF 232 KNCDNIGNNCCDR LLSVRTKYFGRLPDEEYAIFNMYLIF Sbjct: 3188 KNCDNIGNNCCDRLLLSVRTKYFGRLPDEEYAIFNMYLIF 3227