BLASTX nr result
ID: Ophiopogon26_contig00043557
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043557 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC01443.1| hypothetical protein RhiirA5_402820 [Rhizophagus ... 67 9e-11 gb|PKK71734.1| hypothetical protein RhiirC2_848940 [Rhizophagus ... 67 3e-10 gb|PKC72322.1| hypothetical protein RhiirA1_531295 [Rhizophagus ... 67 3e-10 >gb|PKC01443.1| hypothetical protein RhiirA5_402820 [Rhizophagus irregularis] Length = 199 Score = 66.6 bits (161), Expect = 9e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 113 QNEPKIYNTWTEEVLETLRNAVNKHGNKWKYISDNYF 223 QN PKI+ WTEE LETLR AVNKHGNKWKYISDNYF Sbjct: 29 QNRPKIHR-WTEEELETLRIAVNKHGNKWKYISDNYF 64 >gb|PKK71734.1| hypothetical protein RhiirC2_848940 [Rhizophagus irregularis] Length = 297 Score = 66.6 bits (161), Expect = 3e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 113 QNEPKIYNTWTEEVLETLRNAVNKHGNKWKYISDNYF 223 QN PKI+ WTEE LETLR AVNKHGNKWKYISDNYF Sbjct: 29 QNRPKIHR-WTEEELETLRIAVNKHGNKWKYISDNYF 64 >gb|PKC72322.1| hypothetical protein RhiirA1_531295 [Rhizophagus irregularis] gb|PKY28129.1| hypothetical protein RhiirB3_529668 [Rhizophagus irregularis] Length = 325 Score = 66.6 bits (161), Expect = 3e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 113 QNEPKIYNTWTEEVLETLRNAVNKHGNKWKYISDNYF 223 QN PKI+ WTEE LETLR AVNKHGNKWKYISDNYF Sbjct: 29 QNRPKIHR-WTEEELETLRIAVNKHGNKWKYISDNYF 64