BLASTX nr result
ID: Ophiopogon26_contig00043447
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043447 (1272 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC62656.1| hypothetical protein RhiirA1_423533 [Rhizophagus ... 68 6e-11 gb|PKK79688.1| hypothetical protein RhiirC2_726541 [Rhizophagus ... 67 1e-10 >gb|PKC62656.1| hypothetical protein RhiirA1_423533 [Rhizophagus irregularis] gb|PKY21781.1| hypothetical protein RhiirB3_409851 [Rhizophagus irregularis] Length = 56 Score = 67.8 bits (164), Expect = 6e-11 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 6/50 (12%) Frame = -3 Query: 703 MIAPETSARFDVFVT------VDGKSKYSHYLRSQRLLIRWYFVANPKVL 572 MI PETSARF+VFVT + K +SHYLRSQRLLIRWYFVANPKVL Sbjct: 1 MIVPETSARFNVFVTLIYIIIICYKYIHSHYLRSQRLLIRWYFVANPKVL 50 >gb|PKK79688.1| hypothetical protein RhiirC2_726541 [Rhizophagus irregularis] Length = 56 Score = 67.0 bits (162), Expect = 1e-10 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 6/50 (12%) Frame = -3 Query: 703 MIAPETSARFDVFVTVDG------KSKYSHYLRSQRLLIRWYFVANPKVL 572 MI PETSARF+VFVT+ K +SHYLRSQRLLIRWYFVANPKVL Sbjct: 1 MIVPETSARFNVFVTLIYIIIKCYKYIHSHYLRSQRLLIRWYFVANPKVL 50