BLASTX nr result
ID: Ophiopogon26_contig00043343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043343 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC08941.1| hypothetical protein RhiirA5_357308 [Rhizophagus ... 89 2e-20 dbj|GBC44273.1| Tis13_342483 [Rhizophagus irregularis DAOM 18160... 89 2e-20 gb|PKK67675.1| hypothetical protein RhiirC2_751407 [Rhizophagus ... 88 3e-20 >gb|PKC08941.1| hypothetical protein RhiirA5_357308 [Rhizophagus irregularis] gb|PKC70571.1| hypothetical protein RhiirA1_414252 [Rhizophagus irregularis] gb|PKY17276.1| hypothetical protein RhiirB3_404098 [Rhizophagus irregularis] gb|PKY50720.1| hypothetical protein RhiirA4_406777 [Rhizophagus irregularis] Length = 60 Score = 88.6 bits (218), Expect = 2e-20 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -2 Query: 305 TRGARSFLRSLPVEVYPLGAVLTFAVCYGIGQSVYKLQSDRNLRRHPIFH 156 TRG R FLRS+PVEVYPLGAVLTFAVCYGIGQ+ YKLQ+DRNLRR+P ++ Sbjct: 5 TRGVRFFLRSIPVEVYPLGAVLTFAVCYGIGQTAYKLQNDRNLRRYPSYY 54 >dbj|GBC44273.1| Tis13_342483 [Rhizophagus irregularis DAOM 181602] gb|POG83275.1| hypothetical protein GLOIN_2v1490889 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 60 Score = 88.6 bits (218), Expect = 2e-20 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -2 Query: 305 TRGARSFLRSLPVEVYPLGAVLTFAVCYGIGQSVYKLQSDRNLRRHPIFH 156 TRG R FLRS+PVEVYPLGAVLTFAVCYGIGQ+ YKLQ+DRNLRR+P ++ Sbjct: 5 TRGVRFFLRSIPVEVYPLGAVLTFAVCYGIGQTAYKLQNDRNLRRYPSYY 54 >gb|PKK67675.1| hypothetical protein RhiirC2_751407 [Rhizophagus irregularis] Length = 60 Score = 88.2 bits (217), Expect = 3e-20 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -2 Query: 305 TRGARSFLRSLPVEVYPLGAVLTFAVCYGIGQSVYKLQSDRNLRRHPIFH 156 TRG R FLRS+PVEVYPLGAVLTFAVCYGIGQ+ YKLQ+DRNLRR+P ++ Sbjct: 5 TRGVRFFLRSVPVEVYPLGAVLTFAVCYGIGQTAYKLQNDRNLRRYPSYY 54