BLASTX nr result
ID: Ophiopogon26_contig00043185
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043185 (690 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC70705.1| hypothetical protein RhiirA1_94350 [Rhizophagus i... 71 5e-13 >gb|PKC70705.1| hypothetical protein RhiirA1_94350 [Rhizophagus irregularis] Length = 52 Score = 71.2 bits (173), Expect = 5e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 201 FFSLNKSLSSLVSPFIVIPHIVHEEIKNLLFNTYSSNEFS 82 FFSLNKSLSSLV+PFIVI HIVHEEIKNLLFNTYSS E + Sbjct: 12 FFSLNKSLSSLVNPFIVILHIVHEEIKNLLFNTYSSKEMN 51