BLASTX nr result
ID: Ophiopogon26_contig00043172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043172 (839 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK59828.1| hypothetical protein RhiirC2_762329 [Rhizophagus ... 47 6e-06 gb|PKY59755.1| hypothetical protein RhiirA4_412522 [Rhizophagus ... 47 7e-06 dbj|GBC45087.1| hypothetical protein RIR_2774400 [Rhizophagus ir... 47 7e-06 >gb|PKK59828.1| hypothetical protein RhiirC2_762329 [Rhizophagus irregularis] Length = 159 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 17/51 (33%) Frame = +3 Query: 726 LDKKFAEYQTLCNG------VVVGIIKDRA-----------RIEGYRSKNN 827 LDKK EYQTLCNG VVVGIIKDRA R+EGYR+K + Sbjct: 108 LDKKSVEYQTLCNGVKKVLSVVVGIIKDRACAEEEPDRKRVRVEGYRTKKS 158 Score = 32.3 bits (72), Expect(2) = 6e-06 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 680 YLYGTVTTALDWYFLL 727 YLYG VTTA DW+FLL Sbjct: 70 YLYGIVTTARDWHFLL 85 >gb|PKY59755.1| hypothetical protein RhiirA4_412522 [Rhizophagus irregularis] Length = 336 Score = 46.6 bits (109), Expect(2) = 7e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 17/49 (34%) Frame = +3 Query: 726 LDKKFAEYQTLCNG------VVVGIIKDRA-----------RIEGYRSK 821 LDKK EYQTLCNG VVVGIIKDRA R+EGYR+K Sbjct: 287 LDKKSVEYQTLCNGVKKVLSVVVGIIKDRACAEEEPDRKRVRVEGYRTK 335 Score = 32.3 bits (72), Expect(2) = 7e-06 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 680 YLYGTVTTALDWYFLL 727 YLYG VTTA DW+FLL Sbjct: 249 YLYGIVTTARDWHFLL 264 >dbj|GBC45087.1| hypothetical protein RIR_2774400 [Rhizophagus irregularis DAOM 181602] gb|POG73386.1| hypothetical protein GLOIN_2v1587390 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 333 Score = 46.6 bits (109), Expect(2) = 7e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 17/49 (34%) Frame = +3 Query: 726 LDKKFAEYQTLCNG------VVVGIIKDRA-----------RIEGYRSK 821 LDKK EYQTLCNG VVVGIIKDRA R+EGYR+K Sbjct: 284 LDKKSVEYQTLCNGVKKVLSVVVGIIKDRACAEEEPDRKRVRVEGYRTK 332 Score = 32.3 bits (72), Expect(2) = 7e-06 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 680 YLYGTVTTALDWYFLL 727 YLYG VTTA DW+FLL Sbjct: 246 YLYGIVTTARDWHFLL 261