BLASTX nr result
ID: Ophiopogon26_contig00043140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043140 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY39807.1| hypothetical protein RhiirA4_440302 [Rhizophagus ... 67 8e-10 dbj|GBC52092.1| hypothetical protein RIR_3350600 [Rhizophagus ir... 65 3e-09 >gb|PKY39807.1| hypothetical protein RhiirA4_440302 [Rhizophagus irregularis] Length = 402 Score = 67.0 bits (162), Expect = 8e-10 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 154 GSHFSIRFWSFDATRQNPILAVIFVDGMSNYILHLLDSNS 273 G FSIR WS ATRQNPILAV+F+DGMS++ILHLLDSNS Sbjct: 60 GLQFSIRIWSCVATRQNPILAVVFIDGMSDFILHLLDSNS 99 >dbj|GBC52092.1| hypothetical protein RIR_3350600 [Rhizophagus irregularis DAOM 181602] gb|PKC73178.1| hypothetical protein RhiirA1_437739 [Rhizophagus irregularis] gb|PKK78805.1| hypothetical protein RhiirC2_861016 [Rhizophagus irregularis] gb|POG65919.1| hypothetical protein GLOIN_2v1662066 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 402 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 154 GSHFSIRFWSFDATRQNPILAVIFVDGMSNYILHLLDSNS 273 G FSIR WS ATR+NPILAV+F+DGMS++ILHLLDSNS Sbjct: 60 GLQFSIRIWSCVATRKNPILAVVFIDGMSDFILHLLDSNS 99