BLASTX nr result
ID: Ophiopogon26_contig00043042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00043042 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413385.1| PREDICTED: transcription repressor OFP7-like... 58 4e-07 ref|XP_010910821.1| PREDICTED: transcription repressor OFP3-like... 58 6e-07 >ref|XP_009413385.1| PREDICTED: transcription repressor OFP7-like [Musa acuminata subsp. malaccensis] Length = 355 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 264 KERRGREAGELYETGEREGRTCPPASPSSPSKDN 365 KERR RE G YETGE EGRTCPPASPSSPSK + Sbjct: 122 KERRVRETGGYYETGEWEGRTCPPASPSSPSKSS 155 >ref|XP_010910821.1| PREDICTED: transcription repressor OFP3-like [Elaeis guineensis] Length = 360 Score = 57.8 bits (138), Expect = 6e-07 Identities = 32/64 (50%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = +3 Query: 195 GGCRPXXXXXXXXXXXXXXXXXN---KERRGREAGELYETGEREGRTCPPASPSSPSKDN 365 GGCRP KERR RE G YETGE EGR CPPASPSSPSK + Sbjct: 96 GGCRPTRDIPPLVAKREKRRHGKNKKKERRVRETGGFYETGEGEGRMCPPASPSSPSKSS 155 Query: 366 LCNF 377 C++ Sbjct: 156 -CHY 158