BLASTX nr result
ID: Ophiopogon26_contig00042728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00042728 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC11420.1| hypothetical protein RhiirA5_120132 [Rhizophagus ... 66 3e-10 gb|EXX59226.1| Taf11p [Rhizophagus irregularis DAOM 197198w] >gi... 66 1e-09 >gb|PKC11420.1| hypothetical protein RhiirA5_120132 [Rhizophagus irregularis] gb|PKC66975.1| hypothetical protein RhiirA1_173507 [Rhizophagus irregularis] gb|PKK75404.1| hypothetical protein RhiirC2_235766 [Rhizophagus irregularis] gb|POG75620.1| hypothetical protein GLOIN_2v959181 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 182 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 405 RDAYFSIPPTPSSELDQYILHDNDLSEAGTSKVNDN 512 RDAYFSIPPTP+SELDQYILHDNDL E G SKVNDN Sbjct: 116 RDAYFSIPPTPASELDQYILHDNDLIEGG-SKVNDN 150 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +3 Query: 45 MDQRQAPEFTIPRKNS---VGTAKRPKVTKSYSTPAN 146 MDQRQAPEFTI RKNS GT+KRPKVTKSYSTP N Sbjct: 1 MDQRQAPEFTISRKNSASTAGTSKRPKVTKSYSTPIN 37 >gb|EXX59226.1| Taf11p [Rhizophagus irregularis DAOM 197198w] dbj|GBC49187.1| Transcription initiation factor TFIID subunit 11 [Rhizophagus irregularis DAOM 181602] Length = 286 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 405 RDAYFSIPPTPSSELDQYILHDNDLSEAGTSKVNDN 512 RDAYFSIPPTP+SELDQYILHDNDL E G SKVNDN Sbjct: 116 RDAYFSIPPTPASELDQYILHDNDLIEGG-SKVNDN 150 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +3 Query: 45 MDQRQAPEFTIPRKNS---VGTAKRPKVTKSYSTPAN 146 MDQRQAPEFTI RKNS GT+KRPKVTKSYSTP N Sbjct: 1 MDQRQAPEFTISRKNSASTAGTSKRPKVTKSYSTPIN 37