BLASTX nr result
ID: Ophiopogon26_contig00042721
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00042721 (727 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY38657.1| ribosomal protein S5 domain 2-like protein [Rhizo... 70 2e-10 gb|EXX73579.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] 69 5e-10 gb|PKY20584.1| ribosomal protein S5 domain 2-like protein [Rhizo... 69 7e-10 gb|EXX73578.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] >gi... 69 7e-10 gb|PKC60392.1| hypothetical protein RhiirA1_399215, partial [Rhi... 59 2e-07 >gb|PKY38657.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] Length = 312 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 572 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 459 +VLDY GNILD IF+TTRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMTTRAALYNTKIPKTIIQDRGDGE 188 >gb|EXX73579.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] Length = 271 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 572 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 459 +VLDY GNILD IF+ TRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMATRAALYNTKIPKTIIQDRGDGE 188 >gb|PKY20584.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] Length = 312 Score = 68.6 bits (166), Expect = 7e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 572 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 459 +VLDY GNILD IF+ TRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMATRAALYNTKIPKTIIQDRGDGE 188 >gb|EXX73578.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] dbj|GBC23522.1| 3' exosome complex component RRP42 [Rhizophagus irregularis DAOM 181602] gb|PKC16800.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] gb|PKC60582.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] gb|PKK62441.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] gb|POG78152.1| ribosomal protein S5 domain 2-type protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 312 Score = 68.6 bits (166), Expect = 7e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 572 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 459 +VLDY GNILD IF+ TRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMATRAALYNTKIPKTIIQDRGDGE 188 >gb|PKC60392.1| hypothetical protein RhiirA1_399215, partial [Rhizophagus irregularis] Length = 142 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 343 VPTPLDWTSWIETVPAPS*IGLLGLDRADSLLGF 242 +P LDWTSWI +VPAPS IGLLG DRADSLLGF Sbjct: 56 LPASLDWTSWIGSVPAPSWIGLLGFDRADSLLGF 89