BLASTX nr result
ID: Ophiopogon26_contig00042711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00042711 (1744 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63068.1| hypothetical protein RirG_155790 [Rhizophagus irr... 67 8e-10 gb|PKY54575.1| hypothetical protein RhiirA4_473465 [Rhizophagus ... 67 2e-09 gb|PKK67292.1| hypothetical protein RhiirC2_714222 [Rhizophagus ... 62 2e-07 >gb|EXX63068.1| hypothetical protein RirG_155790 [Rhizophagus irregularis DAOM 197198w] dbj|GBC45758.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] gb|POG77837.1| hypothetical protein GLOIN_2v750338 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 100 Score = 66.6 bits (161), Expect = 8e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 401 VSQNVKEAKLEELAVDVTPSGFLAPNNANTKSTED 297 VSQNVKEAKLEE AVDVTPSGF APNNANTKSTED Sbjct: 4 VSQNVKEAKLEESAVDVTPSGFSAPNNANTKSTED 38 >gb|PKY54575.1| hypothetical protein RhiirA4_473465 [Rhizophagus irregularis] Length = 134 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 401 VSQNVKEAKLEELAVDVTPSGFLAPNNANTKSTED 297 VSQNVKEAKLEE AVDVTPSGF APNNANTKSTED Sbjct: 85 VSQNVKEAKLEESAVDVTPSGFSAPNNANTKSTED 119 >gb|PKK67292.1| hypothetical protein RhiirC2_714222 [Rhizophagus irregularis] Length = 174 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 404 LVSQNVKEAKLEELAVDVTPSGFLAPNNANTKSTE 300 L SQNVKEAKLEE AVDVTPSGF APNNANTKST+ Sbjct: 138 LGSQNVKEAKLEESAVDVTPSGFSAPNNANTKSTD 172