BLASTX nr result
ID: Ophiopogon26_contig00042642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00042642 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52985.1| hypothetical protein RirG_248210 [Rhizophagus irr... 107 9e-26 dbj|GBC49216.1| hypothetical protein RIR_3114000 [Rhizophagus ir... 96 2e-21 >gb|EXX52985.1| hypothetical protein RirG_248210 [Rhizophagus irregularis DAOM 197198w] gb|EXX52986.1| hypothetical protein RirG_248210 [Rhizophagus irregularis DAOM 197198w] gb|PKC09185.1| hypothetical protein RhiirA5_375659 [Rhizophagus irregularis] gb|PKY24238.1| hypothetical protein RhiirB3_412801 [Rhizophagus irregularis] Length = 267 Score = 107 bits (267), Expect = 9e-26 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 3 DLSNRVGDLLTPTMNNIRQIGNLNRNQTKNHLSPNTNNEIDKWKEEFAVD 152 DLSNRVGDLLTPTMNNIRQIGNLNRNQTKNHLSPNTNNEIDKWKEEFAVD Sbjct: 217 DLSNRVGDLLTPTMNNIRQIGNLNRNQTKNHLSPNTNNEIDKWKEEFAVD 266 >dbj|GBC49216.1| hypothetical protein RIR_3114000 [Rhizophagus irregularis DAOM 181602] Length = 276 Score = 96.3 bits (238), Expect = 2e-21 Identities = 47/62 (75%), Positives = 48/62 (77%) Frame = +3 Query: 21 GDLLTPTMNNIRQIGNLNRNQTKNHLSPNTNNEIDKWKEEFAVDKLTENNYQSNRDFVTP 200 GDLLTPTMNNIRQIGNLNRNQTKNHLSPNTNNEIDKWKEEFA+ K N F Sbjct: 199 GDLLTPTMNNIRQIGNLNRNQTKNHLSPNTNNEIDKWKEEFALWKEFHNQPAKKYQFYYT 258 Query: 201 KN 206 KN Sbjct: 259 KN 260