BLASTX nr result
ID: Ophiopogon26_contig00041865
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041865 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX75529.1| hypothetical protein RirG_041030 [Rhizophagus irr... 97 3e-23 gb|EXX79949.1| hypothetical protein RirG_000690 [Rhizophagus irr... 97 3e-23 >gb|EXX75529.1| hypothetical protein RirG_041030 [Rhizophagus irregularis DAOM 197198w] gb|EXX78608.1| hypothetical protein RirG_013560 [Rhizophagus irregularis DAOM 197198w] gb|EXX78618.1| hypothetical protein RirG_013470 [Rhizophagus irregularis DAOM 197198w] dbj|GBC34345.1| hypothetical protein RIR_1910100 [Rhizophagus irregularis DAOM 181602] gb|PKC11387.1| hypothetical protein RhiirA5_354262 [Rhizophagus irregularis] gb|PKC69034.1| hypothetical protein RhiirA1_416222 [Rhizophagus irregularis] gb|PKK78287.1| hypothetical protein RhiirC2_730240 [Rhizophagus irregularis] gb|PKY17064.1| hypothetical protein RhiirB3_403765 [Rhizophagus irregularis] gb|PKY42928.1| hypothetical protein RhiirA4_398120 [Rhizophagus irregularis] Length = 82 Score = 97.1 bits (240), Expect = 3e-23 Identities = 51/64 (79%), Positives = 51/64 (79%) Frame = +3 Query: 102 MPGSASPKSPTNQSELSVDSIIDENLNFNEILKDMDKAEGAXXXXXXXXXXXXAKIDAML 281 MPGSASPKSPTNQSELSVDSIIDENLN NEILKDMDKAEGA AKIDAML Sbjct: 1 MPGSASPKSPTNQSELSVDSIIDENLNINEILKDMDKAEGALNELDERLDNLNAKIDAML 60 Query: 282 EEQT 293 EEQT Sbjct: 61 EEQT 64 >gb|EXX79949.1| hypothetical protein RirG_000690 [Rhizophagus irregularis DAOM 197198w] Length = 85 Score = 97.1 bits (240), Expect = 3e-23 Identities = 51/64 (79%), Positives = 51/64 (79%) Frame = +3 Query: 102 MPGSASPKSPTNQSELSVDSIIDENLNFNEILKDMDKAEGAXXXXXXXXXXXXAKIDAML 281 MPGSASPKSPTNQSELSVDSIIDENLN NEILKDMDKAEGA AKIDAML Sbjct: 1 MPGSASPKSPTNQSELSVDSIIDENLNINEILKDMDKAEGALNELDERLDNLNAKIDAML 60 Query: 282 EEQT 293 EEQT Sbjct: 61 EEQT 64