BLASTX nr result
ID: Ophiopogon26_contig00041837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041837 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX55655.1| hypothetical protein RirG_223390 [Rhizophagus irr... 241 6e-80 gb|KXS13366.1| hypothetical protein M427DRAFT_71354 [Gonapodya p... 93 3e-21 gb|OZJ02368.1| hypothetical protein BZG36_04439 [Bifiguratus ade... 71 5e-13 ref|WP_028385920.1| DUF4286 domain-containing protein [Legionell... 58 3e-08 ref|WP_011213629.1| DUF4286 domain-containing protein [Legionell... 55 3e-07 gb|OAQ30245.1| hypothetical protein K457DRAFT_155227 [Mortierell... 55 7e-07 ref|WP_061692008.1| DUF4286 domain-containing protein [Legionell... 54 1e-06 gb|PKN55522.1| DUF4286 domain-containing protein [Deltaproteobac... 54 1e-06 ref|WP_062725903.1| DUF4286 domain-containing protein [Legionell... 54 1e-06 ref|WP_058477267.1| DUF4286 domain-containing protein [Legionell... 54 1e-06 ref|WP_042236603.1| DUF4286 domain-containing protein [Legionell... 54 1e-06 ref|WP_014841491.1| DUF4286 domain-containing protein [Legionell... 53 2e-06 ref|WP_058535343.1| DUF4286 domain-containing protein [Legionell... 53 2e-06 ref|WP_011215360.1| DUF4286 domain-containing protein [Legionell... 53 3e-06 ref|WP_061467372.1| DUF4286 domain-containing protein [Legionell... 53 3e-06 ref|WP_059411110.1| DUF4286 domain-containing protein [Legionell... 53 3e-06 ref|WP_027226842.1| DUF4286 domain-containing protein [Legionell... 53 3e-06 ref|WP_027226678.1| DUF4286 domain-containing protein [Legionell... 53 3e-06 ref|WP_027224911.1| DUF4286 domain-containing protein [Legionell... 53 3e-06 ref|WP_027220702.1| DUF4286 domain-containing protein [Legionell... 53 3e-06 >gb|EXX55655.1| hypothetical protein RirG_223390 [Rhizophagus irregularis DAOM 197198w] dbj|GBC43812.1| hypothetical protein RIR_2673600 [Rhizophagus irregularis DAOM 181602] gb|PKC07561.1| hypothetical protein RhiirA5_479722 [Rhizophagus irregularis] gb|PKC68632.1| hypothetical protein RhiirA1_506633 [Rhizophagus irregularis] gb|PKK74875.1| hypothetical protein RhiirC2_270913 [Rhizophagus irregularis] gb|PKY25023.1| hypothetical protein RhiirB3_509870 [Rhizophagus irregularis] gb|PKY40721.1| hypothetical protein RhiirA4_495649 [Rhizophagus irregularis] gb|POG64643.1| hypothetical protein GLOIN_2v1673248 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 139 Score = 241 bits (614), Expect = 6e-80 Identities = 118/132 (89%), Positives = 125/132 (94%) Frame = +1 Query: 10 SNSTKVIDDNSILPIIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQ 189 +NSTKVI+DNSILPIIYETNFTIALEIAEEFE WLQD+L ETLNKK GFRDAEVF+RDPQ Sbjct: 3 NNSTKVINDNSILPIIYETNFTIALEIAEEFESWLQDHLNETLNKKSGFRDAEVFQRDPQ 62 Query: 190 NDGDPEVKNPDRVHKYFTILFEVDNKDSIDHYLREETPKIQETLQQKFNQQDALVVSSCR 369 ND DPEVKNPDRVHKYFTILFEV+NKDSID YLREE PKIQETL+QKFNQ+DALVVSS R Sbjct: 63 NDDDPEVKNPDRVHKYFTILFEVENKDSIDRYLREEAPKIQETLEQKFNQKDALVVSSRR 122 Query: 370 ILYPVSLWAKRQ 405 ILYPVSLWAKRQ Sbjct: 123 ILYPVSLWAKRQ 134 >gb|KXS13366.1| hypothetical protein M427DRAFT_71354 [Gonapodya prolifera JEL478] Length = 154 Score = 92.8 bits (229), Expect = 3e-21 Identities = 45/132 (34%), Positives = 74/132 (56%), Gaps = 14/132 (10%) Frame = +1 Query: 46 LPIIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEV----- 210 LP++YE + LEI ++F WL+++L L+ P FR A + R+P +D P Sbjct: 19 LPVLYEVELAVELEIYDDFVPWLEEHLSGVLDANPEFRKANAYLRNPLDDTHPSPLHYGR 78 Query: 211 ---------KNPDRVHKYFTILFEVDNKDSIDHYLREETPKIQETLQQKFNQQDALVVSS 363 + D +H+YFTIL+EVDN+DS++ ++ E K+ + KF D +VV+ Sbjct: 79 KPSASLNGKRETDALHRYFTILYEVDNRDSVEKFVEESAGKLVSAARAKFQGGDTVVVAR 138 Query: 364 CRILYPVSLWAK 399 RIL+P+ + A+ Sbjct: 139 TRILHPLYVLAR 150 >gb|OZJ02368.1| hypothetical protein BZG36_04439 [Bifiguratus adelaidae] Length = 131 Score = 70.9 bits (172), Expect = 5e-13 Identities = 37/120 (30%), Positives = 67/120 (55%), Gaps = 6/120 (5%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQ-----NDGDPEVKN 216 ++YE + ++ LE+ E F+ ++Q + + K P F A V+ RDP N D + Sbjct: 3 LLYEISVSVDLEVEEAFQAFIQSHAA-LVGKIPNFSVARVYLRDPTHPVPLNGKDADAPK 61 Query: 217 PDRVHKYFTILFEVDNKDSIDHYLREETPKIQETLQQKFNQQDALV-VSSCRILYPVSLW 393 DR+H+Y+T+ +EV++ S+ ++ +E PK LQ+ N L+ V+S ++ YP+ W Sbjct: 62 ADRMHRYYTVYYEVEDVYSLQAWIEQEEPKFAADLQKLTNGNPELIKVTSRKVQYPLESW 121 >ref|WP_028385920.1| DUF4286 domain-containing protein [Legionella geestiana] gb|KTD04047.1| hypothetical protein Lgee_0290 [Legionella geestiana] Length = 102 Score = 57.8 bits (138), Expect = 3e-08 Identities = 29/96 (30%), Positives = 54/96 (56%) Frame = +1 Query: 46 LPIIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDR 225 + IIYE N ++ +I EE+ WLQ++++ L + PGF+ AEVF+ + + Sbjct: 1 MTIIYEVNLSVDADILEEYVAWLQEHVRLML-QFPGFQSAEVFKEEVALNAPQHA----- 54 Query: 226 VHKYFTILFEVDNKDSIDHYLREETPKIQETLQQKF 333 FT+ + + N+DS++HY +E ++E ++F Sbjct: 55 ----FTVHYRLQNRDSLEHYFKENAAAMREDGLRRF 86 >ref|WP_011213629.1| DUF4286 domain-containing protein [Legionella pneumophila] emb|CAH12433.1| hypothetical protein lpp1282 [Legionella pneumophila str. Paris] gb|ERB42725.1| hypothetical protein N748_01400 [Legionella pneumophila str. 121004] gb|ERH42310.1| hypothetical protein N751_03540 [Legionella pneumophila str. Leg01/11] gb|ERH44306.1| hypothetical protein N750_01610 [Legionella pneumophila str. Leg01/53] gb|ERI47647.1| hypothetical protein N749_01855 [Legionella pneumophila str. Leg01/20] dbj|GAN26453.1| hypothetical protein lpymg_01337 [Legionella pneumophila] emb|CZH67649.1| Uncharacterised protein [Legionella pneumophila] emb|CZH65136.1| Uncharacterised protein [Legionella pneumophila] emb|CZH88252.1| Uncharacterised protein [Legionella pneumophila] emb|CZG05397.1| Uncharacterised protein [Legionella pneumophila] emb|CZI61972.1| Uncharacterised protein [Legionella pneumophila] emb|CZG14496.1| Uncharacterised protein [Legionella pneumophila] emb|CZI97744.1| Uncharacterised protein [Legionella pneumophila] emb|CZG09467.1| Uncharacterised protein [Legionella pneumophila] emb|CZH77354.1| Uncharacterised protein [Legionella pneumophila] emb|CZG24405.1| Uncharacterised protein [Legionella pneumophila] emb|CZI75566.1| Uncharacterised protein [Legionella pneumophila] emb|CZH37047.1| Uncharacterised protein [Legionella pneumophila] emb|CZH79261.1| Uncharacterised protein [Legionella pneumophila] emb|CZG28773.1| Uncharacterised protein [Legionella pneumophila] emb|CZH79082.1| Uncharacterised protein [Legionella pneumophila] emb|CZG35861.1| Uncharacterised protein [Legionella pneumophila] emb|CZG09314.1| Uncharacterised protein [Legionella pneumophila] emb|CZH45980.1| Uncharacterised protein [Legionella pneumophila] emb|CZG04640.1| Uncharacterised protein [Legionella pneumophila] emb|CZG42054.1| Uncharacterised protein [Legionella pneumophila] emb|CZG10244.1| Uncharacterised protein [Legionella pneumophila] emb|CZH35173.1| Uncharacterised protein [Legionella pneumophila] emb|CZG04601.1| Uncharacterised protein [Legionella pneumophila] emb|CZG06851.1| Uncharacterised protein [Legionella pneumophila] emb|CZG39159.1| Uncharacterised protein [Legionella pneumophila] emb|CZH41959.1| Uncharacterised protein [Legionella pneumophila] emb|CZG28718.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ62814.1| Uncharacterised protein [Legionella pneumophila] emb|CZH42454.1| Uncharacterised protein [Legionella pneumophila] emb|CZG24720.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ58271.1| Uncharacterised protein [Legionella pneumophila] emb|CZH92963.1| Uncharacterised protein [Legionella pneumophila] emb|CZI83942.1| Uncharacterised protein [Legionella pneumophila] emb|CZH91421.1| Uncharacterised protein [Legionella pneumophila] emb|CZH88531.1| Uncharacterised protein [Legionella pneumophila] emb|CZH88882.1| Uncharacterised protein [Legionella pneumophila] emb|CZR21829.1| Uncharacterised protein [Legionella pneumophila] gb|ANN95361.1| hypothetical protein A9P84_06445 [Legionella pneumophila] gb|PPK27677.1| DUF4286 domain-containing protein [Legionella pneumophila] Length = 104 Score = 55.5 bits (132), Expect = 3e-07 Identities = 28/88 (31%), Positives = 50/88 (56%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI LEI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDLEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMRE 79 >gb|OAQ30245.1| hypothetical protein K457DRAFT_155227 [Mortierella elongata AG-77] Length = 131 Score = 55.1 bits (131), Expect = 7e-07 Identities = 26/94 (27%), Positives = 50/94 (53%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 ++YE N ++ E AE++ WL+ + KE + K PGF VFR+ P+ G + Sbjct: 25 LVYEVNLSVPREKAEDYIDWLRGFTKEQVKKIPGFLSTMVFRQ-PKPYGLHWLSEEGNAK 83 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQETLQQKF 333 Y T+ + ++++ ++ YL+ + P + Q +F Sbjct: 84 TYITVHYVIESQAHLEEYLKRDQPAVAAAEQDRF 117 >ref|WP_061692008.1| DUF4286 domain-containing protein [Legionella pneumophila] emb|CZG61363.1| Uncharacterised protein [Legionella pneumophila] Length = 104 Score = 53.9 bits (128), Expect = 1e-06 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 4/99 (4%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F WL+ + E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDTEIYSQFRSWLKKHAAEII-QFPGFMQASILKQEKETTAGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE----TLQQKFN 336 TI +++DN+D++ YL E PK++E Q KF+ Sbjct: 53 -KLTIQYQLDNRDNLARYLAELAPKMREEGIHLFQDKFS 90 >gb|PKN55522.1| DUF4286 domain-containing protein [Deltaproteobacteria bacterium HGW-Deltaproteobacteria-14] Length = 110 Score = 53.9 bits (128), Expect = 1e-06 Identities = 34/115 (29%), Positives = 61/115 (53%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 ++YE N + I ++E W+ ++KE L + PGF A + R+PQ++GD + Sbjct: 2 VVYEVNLVVDAAIVGDYERWMAAHIKEML-QIPGFFRARWYGRNPQDEGDAPSSD----- 55 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQETLQQKFNQQDALVVSSCRILYPVSLWA 396 ++TI ++V +D ++ Y RE+ +++ +F +S RIL P SL A Sbjct: 56 THWTIQYDVYTRDDLNRYFREDAARMRGDGVARFGDG---FRASRRILVPRSLEA 107 >ref|WP_062725903.1| DUF4286 domain-containing protein [Legionella pneumophila] Length = 104 Score = 53.5 bits (127), Expect = 1e-06 Identities = 28/88 (31%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI EF+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFVEFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLTRYLSELAPKMRE 79 >ref|WP_058477267.1| DUF4286 domain-containing protein [Legionella steigerwaltii] gb|KTD77352.1| hypothetical protein Lstg_1709 [Legionella steigerwaltii] Length = 104 Score = 53.5 bits (127), Expect = 1e-06 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 4/101 (3%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N I +I +F++WL+ ++KE L + PGF A V + + + D E Sbjct: 2 VIYEVNLAIDGDIFPQFQLWLKKHVKEML-QLPGFIQANVLKPETEETTDQE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE----TLQQKFNQQ 342 T+ ++++N+D ++ Y E PK++E Q KF+ Q Sbjct: 53 -QLTVQYQLENRDFLNVYFAEFAPKMREEGLNLFQNKFSAQ 92 >ref|WP_042236603.1| DUF4286 domain-containing protein [Legionella pneumophila] Length = 104 Score = 53.5 bits (127), Expect = 1e-06 Identities = 30/99 (30%), Positives = 54/99 (54%), Gaps = 4/99 (4%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE----TLQQKFN 336 T+ +++DN+D++ YL E PK++E + Q KF+ Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMREEGIHSFQAKFS 90 >ref|WP_014841491.1| DUF4286 domain-containing protein [Legionella pneumophila] emb|CCD05352.1| conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] emb|CZI45894.1| Uncharacterised protein [Legionella pneumophila] emb|CZO87626.1| Uncharacterised protein [Legionella pneumophila] emb|CZI55374.1| Uncharacterised protein [Legionella pneumophila] emb|CZH31539.1| Uncharacterised protein [Legionella pneumophila] emb|CZN30488.1| Uncharacterised protein [Legionella pneumophila] emb|CZP09445.1| Uncharacterised protein [Legionella pneumophila] emb|CZN52189.1| Uncharacterised protein [Legionella pneumophila] emb|CZO36178.1| Uncharacterised protein [Legionella pneumophila] emb|CZN80212.1| Uncharacterised protein [Legionella pneumophila] emb|CZO87679.1| Uncharacterised protein [Legionella pneumophila] emb|CZM73631.1| Uncharacterised protein [Legionella pneumophila] emb|CZO56194.1| Uncharacterised protein [Legionella pneumophila] emb|CZM71221.1| Uncharacterised protein [Legionella pneumophila] emb|CZO34429.1| Uncharacterised protein [Legionella pneumophila] emb|CZO91912.1| Uncharacterised protein [Legionella pneumophila] emb|CZN96562.1| Uncharacterised protein [Legionella pneumophila] emb|CZH33478.1| Uncharacterised protein [Legionella pneumophila] emb|CZN89654.1| Uncharacterised protein [Legionella pneumophila] emb|CZM63965.1| Uncharacterised protein [Legionella pneumophila] emb|CZN31294.1| Uncharacterised protein [Legionella pneumophila] emb|CZP25780.1| Uncharacterised protein [Legionella pneumophila] emb|CZN99286.1| Uncharacterised protein [Legionella pneumophila] emb|CZN53882.1| Uncharacterised protein [Legionella pneumophila] emb|CZO83562.1| Uncharacterised protein [Legionella pneumophila] emb|CZP13218.1| Uncharacterised protein [Legionella pneumophila] emb|CZO47796.1| Uncharacterised protein [Legionella pneumophila] emb|CZO93603.1| Uncharacterised protein [Legionella pneumophila] emb|CZO07894.1| Uncharacterised protein [Legionella pneumophila] emb|CZP33965.1| Uncharacterised protein [Legionella pneumophila] emb|CZN27884.1| Uncharacterised protein [Legionella pneumophila] emb|CZP44126.1| Uncharacterised protein [Legionella pneumophila] emb|CZN18711.1| Uncharacterised protein [Legionella pneumophila] emb|CZO08639.1| Uncharacterised protein [Legionella pneumophila] emb|CZO78520.1| Uncharacterised protein [Legionella pneumophila] emb|CZO99417.1| Uncharacterised protein [Legionella pneumophila] emb|CZP27317.1| Uncharacterised protein [Legionella pneumophila] emb|CZN60896.1| Uncharacterised protein [Legionella pneumophila] emb|CZM98096.1| Uncharacterised protein [Legionella pneumophila] emb|CZO03645.1| Uncharacterised protein [Legionella pneumophila] emb|CZO71762.1| Uncharacterised protein [Legionella pneumophila] emb|CZP22151.1| Uncharacterised protein [Legionella pneumophila] emb|CZM85024.1| Uncharacterised protein [Legionella pneumophila] emb|CZO32929.1| Uncharacterised protein [Legionella pneumophila] emb|CZO17890.1| Uncharacterised protein [Legionella pneumophila] emb|CZN34488.1| Uncharacterised protein [Legionella pneumophila] emb|CZO63046.1| Uncharacterised protein [Legionella pneumophila] emb|CZP51318.1| Uncharacterised protein [Legionella pneumophila] emb|CZO51781.1| Uncharacterised protein [Legionella pneumophila] emb|CZN23634.1| Uncharacterised protein [Legionella pneumophila] emb|CZN18964.1| Uncharacterised protein [Legionella pneumophila] emb|CZO32345.1| Uncharacterised protein [Legionella pneumophila] emb|CZO35741.1| Uncharacterised protein [Legionella pneumophila] emb|CZP65662.1| Uncharacterised protein [Legionella pneumophila] emb|CZP29858.1| Uncharacterised protein [Legionella pneumophila] emb|CZO60182.1| Uncharacterised protein [Legionella pneumophila] emb|CZO60050.1| Uncharacterised protein [Legionella pneumophila] emb|CZO60936.1| Uncharacterised protein [Legionella pneumophila] emb|CZN18001.1| Uncharacterised protein [Legionella pneumophila] emb|CZN20507.1| Uncharacterised protein [Legionella pneumophila] emb|CZN92104.1| Uncharacterised protein [Legionella pneumophila] emb|CZN21370.1| Uncharacterised protein [Legionella pneumophila] emb|CZM42272.1| Uncharacterised protein [Legionella pneumophila] emb|CZN00888.1| Uncharacterised protein [Legionella pneumophila] emb|CZO63141.1| Uncharacterised protein [Legionella pneumophila] emb|CZN53557.1| Uncharacterised protein [Legionella pneumophila] emb|CZN33336.1| Uncharacterised protein [Legionella pneumophila] emb|CZO87587.1| Uncharacterised protein [Legionella pneumophila] emb|CZN89214.1| Uncharacterised protein [Legionella pneumophila] emb|CZO80783.1| Uncharacterised protein [Legionella pneumophila] emb|CZO11480.1| Uncharacterised protein [Legionella pneumophila] emb|CZM78941.1| Uncharacterised protein [Legionella pneumophila] emb|CZN54668.1| Uncharacterised protein [Legionella pneumophila] emb|CZM79464.1| Uncharacterised protein [Legionella pneumophila] emb|CZO06782.1| Uncharacterised protein [Legionella pneumophila] emb|CZN82245.1| Uncharacterised protein [Legionella pneumophila] emb|CZN97668.1| Uncharacterised protein [Legionella pneumophila] emb|CZP23430.1| Uncharacterised protein [Legionella pneumophila] emb|CZN59097.1| Uncharacterised protein [Legionella pneumophila] emb|CZO49434.1| Uncharacterised protein [Legionella pneumophila] emb|CZM59530.1| Uncharacterised protein [Legionella pneumophila] emb|CZP02074.1| Uncharacterised protein [Legionella pneumophila] emb|CZM82448.1| Uncharacterised protein [Legionella pneumophila] emb|CZP62400.1| Uncharacterised protein [Legionella pneumophila] emb|CZM99821.1| Uncharacterised protein [Legionella pneumophila] emb|CZN79521.1| Uncharacterised protein [Legionella pneumophila] emb|CZM83391.1| Uncharacterised protein [Legionella pneumophila] emb|CZM80599.1| Uncharacterised protein [Legionella pneumophila] emb|CZN41877.1| Uncharacterised protein [Legionella pneumophila] emb|CZN86145.1| Uncharacterised protein [Legionella pneumophila] emb|CZN13452.1| Uncharacterised protein [Legionella pneumophila] emb|CZN91241.1| Uncharacterised protein [Legionella pneumophila] emb|CZN62669.1| Uncharacterised protein [Legionella pneumophila] emb|CZO32546.1| Uncharacterised protein [Legionella pneumophila] emb|CZI58944.1| Uncharacterised protein [Legionella pneumophila] emb|CZM61582.1| Uncharacterised protein [Legionella pneumophila] emb|CZI20268.1| Uncharacterised protein [Legionella pneumophila] emb|CZN12453.1| Uncharacterised protein [Legionella pneumophila] emb|CZP54479.1| Uncharacterised protein [Legionella pneumophila] emb|CZP18483.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ03010.1| Uncharacterised protein [Legionella pneumophila] emb|CZP53440.1| Uncharacterised protein [Legionella pneumophila] emb|CZR29777.1| Uncharacterised protein [Legionella pneumophila] Length = 104 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/88 (30%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFVQFQAWLKKHIAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMRE 79 >ref|WP_058535343.1| DUF4286 domain-containing protein [Legionella saoudiensis] Length = 104 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/94 (28%), Positives = 54/94 (57%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N I +I +F++WL+++ KE L + PGF A + + + ++D D E Sbjct: 2 VIYEVNLAIDRDIYSQFQLWLKEHAKEML-QFPGFIKASILKPENESDSDKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQETLQQKF 333 T+ ++++N++S++ Y + + K++E KF Sbjct: 53 -KLTVQYQLENRESLNVYFTQFSAKMREDGINKF 85 >ref|WP_011215360.1| DUF4286 domain-containing protein [Legionella pneumophila] emb|CAH15521.1| hypothetical protein lpl1281 [Legionella pneumophila str. Lens] gb|AOW52123.1| hypothetical protein BE841_06445 [Legionella pneumophila subsp. pneumophila] gb|AOW54286.1| hypothetical protein BE842_02315 [Legionella pneumophila subsp. pneumophila] gb|AOW57421.1| hypothetical protein BE843_03665 [Legionella pneumophila subsp. pneumophila] gb|AOW59653.1| hypothetical protein BE844_00030 [Legionella pneumophila subsp. pneumophila] gb|AOW62918.1| hypothetical protein BE845_02020 [Legionella pneumophila subsp. pneumophila] gb|AOW67800.1| hypothetical protein BE846_12870 [Legionella pneumophila subsp. pneumophila] Length = 104 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/88 (30%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDQEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEEETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLTRYLSELAPKMRE 79 >ref|WP_061467372.1| DUF4286 domain-containing protein [Legionella pneumophila] Length = 104 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/88 (30%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNITIDPEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMRE 79 >ref|WP_059411110.1| DUF4286 domain-containing protein [Legionella pneumophila] dbj|GAN17256.1| hypothetical protein lpbnt_01359 [Legionella pneumophila] dbj|GAN20362.1| hypothetical protein lpofk_01360 [Legionella pneumophila] emb|CZH30068.1| Uncharacterised protein [Legionella pneumophila] emb|CZI06138.1| Uncharacterised protein [Legionella pneumophila] Length = 104 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/88 (30%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMRE 79 >ref|WP_027226842.1| DUF4286 domain-containing protein [Legionella pneumophila] gb|KXB24181.1| hypothetical protein PtVF89_12650 [Legionella pneumophila] gb|KXB26096.1| hypothetical protein PtVF66_06355 [Legionella pneumophila] emb|CZG01274.1| Uncharacterised protein [Legionella pneumophila] emb|CZG03092.1| Uncharacterised protein [Legionella pneumophila] gb|KZX34530.1| hypothetical protein PtVFX2014_05915 [Legionella pneumophila] gb|APF02976.1| hypothetical protein BIZ52_06230 [Legionella pneumophila subsp. fraseri] gb|APF06006.1| hypothetical protein BIZ51_06345 [Legionella pneumophila subsp. fraseri] gb|AUB68465.1| hypothetical protein BJK09_06270 [Legionella pneumophila] gb|AUB71438.1| hypothetical protein BJK08_06265 [Legionella pneumophila] gb|PPK30442.1| DUF4286 domain-containing protein [Legionella pneumophila] Length = 104 Score = 52.8 bits (125), Expect = 3e-06 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 4/99 (4%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFLQFQAWLKKHVAEII-QFPGFMQAYILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE----TLQQKFN 336 T+ +++DN+D++ YL E PK++E Q KF+ Sbjct: 53 -KLTVQYQLDNRDNLARYLAELAPKMREEGIHLFQDKFS 90 >ref|WP_027226678.1| DUF4286 domain-containing protein [Legionella pneumophila] emb|CZG41036.1| Uncharacterised protein [Legionella pneumophila] emb|CZG48869.1| Uncharacterised protein [Legionella pneumophila] emb|CZG85299.1| Uncharacterised protein [Legionella pneumophila] emb|CZG70291.1| Uncharacterised protein [Legionella pneumophila] gb|AMQ27618.1| hypothetical protein lpt_06305 [Legionella pneumophila subsp. pneumophila] gb|PQM71975.1| DUF4286 domain-containing protein [Legionella pneumophila] Length = 104 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/88 (30%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMRE 79 >ref|WP_027224911.1| DUF4286 domain-containing protein [Legionella pneumophila] emb|CZI55044.1| Uncharacterised protein [Legionella pneumophila] emb|CZI03367.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ21976.1| Uncharacterised protein [Legionella pneumophila] gb|ANH12694.1| hypothetical protein A5478_06520 [Legionella pneumophila] gb|ANH15661.1| hypothetical protein A5480_06515 [Legionella pneumophila] gb|ANH18627.1| hypothetical protein A5479_06515 [Legionella pneumophila] gb|AOU42969.1| hypothetical protein A9E83_06390 [Legionella pneumophila] gb|APX19514.1| hypothetical protein A1D14_06530 [Legionella pneumophila] gb|AQL11691.1| hypothetical protein A1D13_06530 [Legionella pneumophila] emb|SNV95795.1| Uncharacterised protein [Legionella pneumophila] Length = 104 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/88 (30%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMRE 79 >ref|WP_027220702.1| DUF4286 domain-containing protein [Legionella pneumophila] emb|CZJ25837.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ67943.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ65420.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ22054.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ80005.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ47146.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ05950.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ06828.1| Uncharacterised protein [Legionella pneumophila] emb|CZG31230.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ46151.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ48056.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ20943.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ30016.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ21356.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ17024.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ18386.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ23415.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ16626.1| Uncharacterised protein [Legionella pneumophila] emb|CZJ37111.1| Uncharacterised protein [Legionella pneumophila] emb|CZP35805.1| Uncharacterised protein [Legionella pneumophila] emb|CZP50467.1| Uncharacterised protein [Legionella pneumophila] emb|CZP07393.1| Uncharacterised protein [Legionella pneumophila] emb|CZO74225.1| Uncharacterised protein [Legionella pneumophila] emb|CZP77879.1| Uncharacterised protein [Legionella pneumophila] emb|CZH47462.1| Uncharacterised protein [Legionella pneumophila] emb|CZH63460.1| Uncharacterised protein [Legionella pneumophila] emb|CZP26505.1| Uncharacterised protein [Legionella pneumophila] emb|CZP09030.1| Uncharacterised protein [Legionella pneumophila] emb|CZP10624.1| Uncharacterised protein [Legionella pneumophila] emb|CZO79975.1| Uncharacterised protein [Legionella pneumophila] emb|CZO89741.1| Uncharacterised protein [Legionella pneumophila] emb|CZP28838.1| Uncharacterised protein [Legionella pneumophila] emb|CZP36358.1| Uncharacterised protein [Legionella pneumophila] emb|CZP13919.1| Uncharacterised protein [Legionella pneumophila] emb|CZO79523.1| Uncharacterised protein [Legionella pneumophila] emb|CZH86419.1| Uncharacterised protein [Legionella pneumophila] emb|CZO94559.1| Uncharacterised protein [Legionella pneumophila] emb|CZH76671.1| Uncharacterised protein [Legionella pneumophila] emb|CZP12677.1| Uncharacterised protein [Legionella pneumophila] emb|CZH65206.1| Uncharacterised protein [Legionella pneumophila] emb|CZG38182.1| Uncharacterised protein [Legionella pneumophila] emb|CZP06078.1| Uncharacterised protein [Legionella pneumophila] emb|CZP69450.1| Uncharacterised protein [Legionella pneumophila] emb|CZP22818.1| Uncharacterised protein [Legionella pneumophila] emb|CZP02365.1| Uncharacterised protein [Legionella pneumophila] emb|CZP25414.1| Uncharacterised protein [Legionella pneumophila] emb|CZP28821.1| Uncharacterised protein [Legionella pneumophila] emb|CZP50767.1| Uncharacterised protein [Legionella pneumophila] emb|CZP60995.1| Uncharacterised protein [Legionella pneumophila] emb|CZP62556.1| Uncharacterised protein [Legionella pneumophila] emb|CZP70874.1| Uncharacterised protein [Legionella pneumophila] emb|CZP52338.1| Uncharacterised protein [Legionella pneumophila] emb|CZO87664.1| Uncharacterised protein [Legionella pneumophila] emb|CZP01415.1| Uncharacterised protein [Legionella pneumophila] emb|CZR16289.1| Uncharacterised protein [Legionella pneumophila] gb|AMV14056.1| hypothetical protein ULM_13750 [Legionella pneumophila] gb|ANN92318.1| hypothetical protein A9P85_06635 [Legionella pneumophila] emb|SFZ40022.1| Uncharacterised protein [Legionella pneumophila] emb|SNV13997.1| Uncharacterised protein [Legionella pneumophila] Length = 104 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/88 (30%), Positives = 49/88 (55%) Frame = +1 Query: 52 IIYETNFTIALEIAEEFEIWLQDYLKETLNKKPGFRDAEVFRRDPQNDGDPEVKNPDRVH 231 +IYE N TI EI +F+ WL+ ++ E + + PGF A + +++ + E Sbjct: 2 VIYEVNLTIDPEIFVQFQAWLKKHVAEII-QFPGFMQACILKQEKETKSGKE-------- 52 Query: 232 KYFTILFEVDNKDSIDHYLREETPKIQE 315 T+ +++DN+D++ YL E PK++E Sbjct: 53 -KLTVQYQLDNRDNLSRYLSELAPKMRE 79