BLASTX nr result
ID: Ophiopogon26_contig00041457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041457 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC43373.1| hypothetical protein RIR_2639200 [Rhizophagus ir... 63 2e-10 dbj|GBC31658.1| hypothetical protein RIR_1694700 [Rhizophagus ir... 53 1e-06 >dbj|GBC43373.1| hypothetical protein RIR_2639200 [Rhizophagus irregularis DAOM 181602] gb|PKC14883.1| hypothetical protein RhiirA5_495015 [Rhizophagus irregularis] Length = 95 Score = 62.8 bits (151), Expect = 2e-10 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 12/64 (18%) Frame = +1 Query: 160 YSVCVSGSDIDRRKFCRYKWYNLFRNSNVEK------------VMGVKILYR*RNNFVID 303 Y VC SGSDIDRRK CRYKW NLFRNS+VEK + V+I+ R +NN ++ Sbjct: 22 YIVCASGSDIDRRKLCRYKWCNLFRNSSVEKDCWGVVSNRCKNKLSVEIIPRAKNNLMLG 81 Query: 304 TIFS 315 F+ Sbjct: 82 LAFN 85 >dbj|GBC31658.1| hypothetical protein RIR_1694700 [Rhizophagus irregularis DAOM 181602] Length = 73 Score = 52.8 bits (125), Expect = 1e-06 Identities = 30/59 (50%), Positives = 35/59 (59%) Frame = +1 Query: 160 YSVCVSGSDIDRRKFCRYKWYNLFRNSNVEKVMGVKILYR*RNNFVIDTIFSENVREQR 336 Y VCV+GSDIDRRKFC+Y W NLFR S V K Y + VID IF R ++ Sbjct: 22 YIVCVNGSDIDRRKFCKYGWDNLFRGSIVAKG------YEGEHKLVID-IFQNRERTKK 73