BLASTX nr result
ID: Ophiopogon26_contig00041382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041382 (1476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC32077.1| hypothetical protein RIR_1726700 [Rhizophagus ir... 94 2e-19 dbj|GBC32076.1| hypothetical protein RIR_1726700 [Rhizophagus ir... 94 2e-19 >dbj|GBC32077.1| hypothetical protein RIR_1726700 [Rhizophagus irregularis DAOM 181602] Length = 96 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +3 Query: 1026 EFDNFNMFIVLTTNNDSAMTVHGRDIACTSIKPNVTLYYVVKVLAKNIYN 1175 EF+NFNM I LTT+NDSAMTV+GRDIACT IKPNVTLYYVVKVLAKNIYN Sbjct: 47 EFENFNMIIALTTDNDSAMTVYGRDIACTPIKPNVTLYYVVKVLAKNIYN 96 >dbj|GBC32076.1| hypothetical protein RIR_1726700 [Rhizophagus irregularis DAOM 181602] Length = 98 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +3 Query: 1026 EFDNFNMFIVLTTNNDSAMTVHGRDIACTSIKPNVTLYYVVKVLAKNIYN 1175 EF+NFNM I LTT+NDSAMTV+GRDIACT IKPNVTLYYVVKVLAKNIYN Sbjct: 49 EFENFNMIIALTTDNDSAMTVYGRDIACTPIKPNVTLYYVVKVLAKNIYN 98