BLASTX nr result
ID: Ophiopogon26_contig00041354
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041354 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK56495.1| hypothetical protein RhiirC2_872019, partial [Rhi... 91 2e-19 >gb|PKK56495.1| hypothetical protein RhiirC2_872019, partial [Rhizophagus irregularis] Length = 202 Score = 90.5 bits (223), Expect = 2e-19 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = -2 Query: 469 SDEYLEREKQKSRKTRIENSHQAESSNCSYRLNNVLDVQESFDENDKEEVIQNGE 305 SDEY EREKQKSRKT IENSHQAE CSYRLNNVL+VQESFDEND+EEVIQN E Sbjct: 151 SDEYPEREKQKSRKTSIENSHQAE---CSYRLNNVLNVQESFDENDEEEVIQNVE 202