BLASTX nr result
ID: Ophiopogon26_contig00041327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041327 (716 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16250.1| hypothetical protein RIR_0447200 [Rhizophagus ir... 64 3e-18 >dbj|GBC16250.1| hypothetical protein RIR_0447200 [Rhizophagus irregularis DAOM 181602] Length = 76 Score = 63.9 bits (154), Expect(2) = 3e-18 Identities = 30/31 (96%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 461 NRSALDNY-GNNYCVCTNNYVSIVPTRIRVP 372 NRSALDNY GNNYCVCTNNYVSIVPTRIRVP Sbjct: 41 NRSALDNYVGNNYCVCTNNYVSIVPTRIRVP 71 Score = 56.6 bits (135), Expect(2) = 3e-18 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 636 TGLDFITRYFLGRLDVDFGLGSQSGIGIESW 544 TGLDFI RYFLGRLDV+FGLG QSGIGIE++ Sbjct: 5 TGLDFIIRYFLGRLDVNFGLGPQSGIGIENF 35