BLASTX nr result
ID: Ophiopogon26_contig00041252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041252 (597 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY46773.1| hypothetical protein RhiirA4_543542 [Rhizophagus ... 79 5e-15 >gb|PKY46773.1| hypothetical protein RhiirA4_543542 [Rhizophagus irregularis] Length = 164 Score = 79.0 bits (193), Expect = 5e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 RGCAFIESKILKALISWDQAHRALKENLYSACTYRGC 2 RGCAFIESKIL+ALISWDQ HRALKENLYSACTYRGC Sbjct: 107 RGCAFIESKILRALISWDQVHRALKENLYSACTYRGC 143