BLASTX nr result
ID: Ophiopogon26_contig00041182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00041182 (758 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC05220.1| hypothetical protein RhiirA5_401087, partial [Rhi... 67 5e-11 >gb|PKC05220.1| hypothetical protein RhiirA5_401087, partial [Rhizophagus irregularis] Length = 82 Score = 67.4 bits (163), Expect = 5e-11 Identities = 34/55 (61%), Positives = 37/55 (67%), Gaps = 10/55 (18%) Frame = +2 Query: 623 KVRNFLDCTWM----------ELRRSATSWIAPGWNFEGLQVTGRFLNENLNSCL 757 +V NFLD W E+ RSATSWIAPGWNFEGLQV+ RFLN NLN CL Sbjct: 21 QVSNFLDNIWNLKKNKDFQGNEICRSATSWIAPGWNFEGLQVSERFLNANLNGCL 75