BLASTX nr result
ID: Ophiopogon26_contig00040915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040915 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY39353.1| hypothetical protein RhiirA4_440001 [Rhizophagus ... 108 1e-27 gb|EXX55055.1| hypothetical protein RirG_228740 [Rhizophagus irr... 108 1e-27 >gb|PKY39353.1| hypothetical protein RhiirA4_440001 [Rhizophagus irregularis] Length = 171 Score = 108 bits (271), Expect = 1e-27 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = -3 Query: 219 MKIIQITFCFLAFVATFASATINILFPSSKYYLVAGQTNELMWTSDINDTSPFSIFLVN 43 MKIIQITFC LAF+ATF SATINILFPSSKYYLVAGQTNE+MWTS+I DT PFSIFL+N Sbjct: 1 MKIIQITFCLLAFIATFVSATINILFPSSKYYLVAGQTNEIMWTSEITDTLPFSIFLIN 59 >gb|EXX55055.1| hypothetical protein RirG_228740 [Rhizophagus irregularis DAOM 197198w] dbj|GBC47460.1| hypothetical protein RIR_2968700 [Rhizophagus irregularis DAOM 181602] gb|PKC09909.1| hypothetical protein RhiirA5_356142 [Rhizophagus irregularis] gb|POG74550.1| hypothetical protein GLOIN_2v1574867 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 171 Score = 108 bits (271), Expect = 1e-27 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = -3 Query: 219 MKIIQITFCFLAFVATFASATINILFPSSKYYLVAGQTNELMWTSDINDTSPFSIFLVN 43 MKIIQITFC LAF+ATF SATINILFPSSKYYLVAGQTNE+MWTS+I DT PFSIFL+N Sbjct: 1 MKIIQITFCLLAFIATFVSATINILFPSSKYYLVAGQTNEIMWTSEITDTLPFSIFLIN 59