BLASTX nr result
ID: Ophiopogon26_contig00040777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040777 (607 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC15792.1| hypothetical protein RIR_0409000 [Rhizophagus ir... 49 2e-06 >dbj|GBC15792.1| hypothetical protein RIR_0409000 [Rhizophagus irregularis DAOM 181602] Length = 107 Score = 49.3 bits (116), Expect(2) = 2e-06 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 12/44 (27%) Frame = +2 Query: 134 HYCAGT------------IVTSSISSLGEKSFLDACNLVPISQL 229 HYC GT + TSSISSLGEKS DACNLVPISQL Sbjct: 64 HYCTGTTTTESSITTTNIVTTSSISSLGEKSCPDACNLVPISQL 107 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +3 Query: 36 VITDLFLFNSFKKTSVFLSCN-DSAFAIVVLFQF 134 V+ D+ + F K SV LS N DSAFA+VVLF + Sbjct: 32 VLYDVSTASFFLKASVSLSSNNDSAFAMVVLFHY 65