BLASTX nr result
ID: Ophiopogon26_contig00040630
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040630 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX71084.1| hypothetical protein RirG_081830 [Rhizophagus irr... 205 7e-66 >gb|EXX71084.1| hypothetical protein RirG_081830 [Rhizophagus irregularis DAOM 197198w] dbj|GBC12929.1| hypothetical protein RIR_0173900 [Rhizophagus irregularis DAOM 181602] gb|PKC11958.1| hypothetical protein RhiirA5_465534 [Rhizophagus irregularis] gb|PKC71596.1| hypothetical protein RhiirA1_531872 [Rhizophagus irregularis] gb|PKK73842.1| hypothetical protein RhiirC2_822507 [Rhizophagus irregularis] gb|PKY18385.1| hypothetical protein RhiirB3_431196 [Rhizophagus irregularis] gb|PKY45362.1| hypothetical protein RhiirA4_443688 [Rhizophagus irregularis] gb|POG67900.1| hypothetical protein GLOIN_2v1642285 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 125 Score = 205 bits (522), Expect = 7e-66 Identities = 107/121 (88%), Positives = 108/121 (89%) Frame = +1 Query: 1 VDDFEKNLNDLDSELDNIQKCAQEILQKVDNSFSYPYSISSVTNELNVLLLATQHFEKRA 180 VDDFEKNLNDLDSELDNIQKCAQEILQKV+NSFSYPYSISSVTNELNVLLLATQHFEKRA Sbjct: 5 VDDFEKNLNDLDSELDNIQKCAQEILQKVENSFSYPYSISSVTNELNVLLLATQHFEKRA 64 Query: 181 KSFGVXXXXXXXXXXXXXDIKAINEPGRLNTMVEEKKLAVDALNQESKRIADNAKAAYQL 360 KSFGV DIKAINEPGRLNTMVEEKKLAVDALNQESKRIADNAKAAYQL Sbjct: 65 KSFGVTSLTTNSTTAASTDIKAINEPGRLNTMVEEKKLAVDALNQESKRIADNAKAAYQL 124 Query: 361 Q 363 Q Sbjct: 125 Q 125