BLASTX nr result
ID: Ophiopogon26_contig00040569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040569 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX50289.1| hypothetical protein RirG_272230 [Rhizophagus irr... 99 1e-24 gb|PKY49428.1| hypothetical protein RhiirA4_405436 [Rhizophagus ... 99 1e-24 gb|EXX50288.1| hypothetical protein RirG_272230 [Rhizophagus irr... 99 1e-24 dbj|GBC15950.1| Mitotic-spindle organizing protein 1 [Rhizophagu... 99 3e-24 ref|XP_021886409.1| mitotic-spindle organizing gamma-tubulin rin... 77 3e-16 gb|KFH68368.1| hypothetical protein MVEG_05186 [Mortierella vert... 75 1e-15 gb|EWC45738.1| mitotic-spindle organizing protein 1 [Drechslerel... 75 2e-15 gb|OAQ31041.1| mitotic-spindle organizing protein 1 [Mortierella... 74 5e-15 ref|XP_016604632.1| mitotic-spindle organizing protein 1 [Spizel... 73 8e-15 ref|XP_011126593.1| hypothetical protein AOL_s00188g42 [Arthrobo... 73 2e-14 gb|POG75137.1| mitotic-spindle organizing protein 1 [Rhizophagus... 72 2e-14 ref|XP_019025379.1| hypothetical protein SAICODRAFT_29770 [Saito... 71 4e-14 emb|CBJ31611.1| conserved unknown protein [Ectocarpus siliculosus] 71 4e-14 ref|XP_005833860.1| hypothetical protein GUITHDRAFT_152235 [Guil... 72 4e-14 gb|POG75138.1| mitotic-spindle organizing protein 1 [Rhizophagus... 71 5e-14 gb|EPS37158.1| hypothetical protein H072_9215 [Dactylellina hapt... 73 1e-13 ref|XP_002976972.1| hypothetical protein SELMODRAFT_9275, partia... 70 1e-13 ref|XP_013410601.1| mitotic-spindle organizing protein 1 [Lingul... 70 2e-13 ref|XP_004364387.1| hypothetical protein CAOG_01519 [Capsaspora ... 70 2e-13 gb|EQL27805.1| mitotic-spindle organizing protein 1, variant [Bl... 70 3e-13 >gb|EXX50289.1| hypothetical protein RirG_272230 [Rhizophagus irregularis DAOM 197198w] Length = 90 Score = 99.0 bits (245), Expect = 1e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 LHEMSTLLNTGLDRDTLSL LNLCENGVNPEALAAVIKELRRESVSLKSFD Sbjct: 6 LHEMSTLLNTGLDRDTLSLCLNLCENGVNPEALAAVIKELRRESVSLKSFD 56 >gb|PKY49428.1| hypothetical protein RhiirA4_405436 [Rhizophagus irregularis] Length = 100 Score = 99.0 bits (245), Expect = 1e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 LHEMSTLLNTGLDRDTLSL LNLCENGVNPEALAAVIKELRRESVSLKSFD Sbjct: 16 LHEMSTLLNTGLDRDTLSLCLNLCENGVNPEALAAVIKELRRESVSLKSFD 66 >gb|EXX50288.1| hypothetical protein RirG_272230 [Rhizophagus irregularis DAOM 197198w] gb|PKC05257.1| hypothetical protein RhiirA5_361581 [Rhizophagus irregularis] gb|PKC69942.1| hypothetical protein RhiirA1_414943 [Rhizophagus irregularis] gb|PKK75816.1| hypothetical protein RhiirC2_735788 [Rhizophagus irregularis] gb|PKY28072.1| hypothetical protein RhiirB3_416690 [Rhizophagus irregularis] Length = 100 Score = 99.0 bits (245), Expect = 1e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 LHEMSTLLNTGLDRDTLSL LNLCENGVNPEALAAVIKELRRESVSLKSFD Sbjct: 16 LHEMSTLLNTGLDRDTLSLCLNLCENGVNPEALAAVIKELRRESVSLKSFD 66 >dbj|GBC15950.1| Mitotic-spindle organizing protein 1 [Rhizophagus irregularis DAOM 181602] Length = 126 Score = 99.0 bits (245), Expect = 3e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 LHEMSTLLNTGLDRDTLSL LNLCENGVNPEALAAVIKELRRESVSLKSFD Sbjct: 16 LHEMSTLLNTGLDRDTLSLCLNLCENGVNPEALAAVIKELRRESVSLKSFD 66 >ref|XP_021886409.1| mitotic-spindle organizing gamma-tubulin ring associated-domain-containing protein [Lobosporangium transversale] gb|ORZ28736.1| mitotic-spindle organizing gamma-tubulin ring associated-domain-containing protein [Lobosporangium transversale] Length = 76 Score = 77.0 bits (188), Expect = 3e-16 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKS 208 L EMSTLLNTGLDR+TLS+ ++LCE+GVNPEALAAVIKELRRE+ S K+ Sbjct: 26 LTEMSTLLNTGLDRETLSVCVSLCESGVNPEALAAVIKELRREAASAKT 74 >gb|KFH68368.1| hypothetical protein MVEG_05186 [Mortierella verticillata NRRL 6337] Length = 77 Score = 75.5 bits (184), Expect = 1e-15 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 L EMS++LNTGLDR+TLS+ ++LCE+GVNPEALAAVIKELRRES S + D Sbjct: 26 LTEMSSILNTGLDRETLSICVSLCESGVNPEALAAVIKELRRESASTRVTD 76 >gb|EWC45738.1| mitotic-spindle organizing protein 1 [Drechslerella stenobrocha 248] Length = 75 Score = 75.1 bits (183), Expect = 2e-15 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 LHE+STLLNT LDR TLSL ++L ENGVNPEALAAVIKELRRES L+ D Sbjct: 25 LHEISTLLNTKLDRTTLSLCVSLIENGVNPEALAAVIKELRRESTRLREDD 75 >gb|OAQ31041.1| mitotic-spindle organizing protein 1 [Mortierella elongata AG-77] Length = 90 Score = 74.3 bits (181), Expect = 5e-15 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLK 211 L EMS++LNTGLDR+TLS+ ++LCE+GVNPEALAAVIKELRRES S + Sbjct: 27 LTEMSSILNTGLDRETLSVCVSLCESGVNPEALAAVIKELRRESASTR 74 >ref|XP_016604632.1| mitotic-spindle organizing protein 1 [Spizellomyces punctatus DAOM BR117] gb|KNC96592.1| mitotic-spindle organizing protein 1 [Spizellomyces punctatus DAOM BR117] Length = 67 Score = 73.2 bits (178), Expect = 8e-15 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLK 211 LHE+S +LNT LDR+TLSL ++LCE+GVNPEALAAVIKEL+RES +L+ Sbjct: 15 LHEISRILNTSLDRETLSLCVSLCESGVNPEALAAVIKELKRESRALR 62 >ref|XP_011126593.1| hypothetical protein AOL_s00188g42 [Arthrobotrys oligospora ATCC 24927] gb|EGX44704.1| hypothetical protein AOL_s00188g42 [Arthrobotrys oligospora ATCC 24927] Length = 81 Score = 72.8 bits (177), Expect = 2e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 LHE+STLLNT LDR TLSL ++L ENGVNPEALAAVIKELR+ES L+ D Sbjct: 24 LHEISTLLNTKLDRTTLSLCVSLIENGVNPEALAAVIKELRKESERLQEED 74 >gb|POG75137.1| mitotic-spindle organizing protein 1 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 58 Score = 72.0 bits (175), Expect = 2e-14 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKEL 235 LHEMSTLLNTGLDRDTLSL LNLCENGVNPEALA I EL Sbjct: 16 LHEMSTLLNTGLDRDTLSLCLNLCENGVNPEALAVSIFEL 55 >ref|XP_019025379.1| hypothetical protein SAICODRAFT_29770 [Saitoella complicata NRRL Y-17804] gb|ODQ54266.1| hypothetical protein SAICODRAFT_29770 [Saitoella complicata NRRL Y-17804] Length = 62 Score = 71.2 bits (173), Expect = 4e-14 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKS 208 L+E+S LLNTGLD++TLSL ++LCENGVNPEALAAVI+ELR E LK+ Sbjct: 14 LNEISLLLNTGLDKNTLSLCVSLCENGVNPEALAAVIRELRSEKEMLKA 62 >emb|CBJ31611.1| conserved unknown protein [Ectocarpus siliculosus] Length = 64 Score = 71.2 bits (173), Expect = 4e-14 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSL 214 LHE+ST+L+TGLDR TLSL L L E+GVNPEALAAV+KELRRE+ +L Sbjct: 14 LHEISTILDTGLDRKTLSLLLELIESGVNPEALAAVVKELRREAATL 60 >ref|XP_005833860.1| hypothetical protein GUITHDRAFT_152235 [Guillardia theta CCMP2712] gb|EKX46880.1| hypothetical protein GUITHDRAFT_152235 [Guillardia theta CCMP2712] Length = 78 Score = 71.6 bits (174), Expect = 4e-14 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLK 211 L EMS LLNTGLD+ TL++ + LCENGVNPEALA V++ELRRES +LK Sbjct: 15 LFEMSNLLNTGLDKPTLNILIELCENGVNPEALAHVVRELRRESAALK 62 >gb|POG75138.1| mitotic-spindle organizing protein 1 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 53 Score = 70.9 bits (172), Expect = 5e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELR 232 LHEMSTLLNTGLDRDTLSL LNLCENGVNPEALA + + L+ Sbjct: 6 LHEMSTLLNTGLDRDTLSLCLNLCENGVNPEALAXIFQLLQ 46 >gb|EPS37158.1| hypothetical protein H072_9215 [Dactylellina haptotyla CBS 200.50] Length = 167 Score = 72.8 bits (177), Expect = 1e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 L+E+STLLNT LDR TLSL ++L ENGVNPEALAAVIKELRRES L+ D Sbjct: 117 LYEISTLLNTKLDRTTLSLCVSLVENGVNPEALAAVIKELRRESTRLREED 167 >ref|XP_002976972.1| hypothetical protein SELMODRAFT_9275, partial [Selaginella moellendorffii] ref|XP_002980712.1| hypothetical protein SELMODRAFT_9273, partial [Selaginella moellendorffii] gb|EFJ18363.1| hypothetical protein SELMODRAFT_9273, partial [Selaginella moellendorffii] gb|EFJ22082.1| hypothetical protein SELMODRAFT_9275, partial [Selaginella moellendorffii] Length = 58 Score = 69.7 bits (169), Expect = 1e-13 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = -3 Query: 351 HEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLK 211 H ++ LLNTGLDR TLS+ + LCE+GVNPEALAAV+KELRRES +++ Sbjct: 12 HHIANLLNTGLDRKTLSICIALCEHGVNPEALAAVVKELRRESAAVQ 58 >ref|XP_013410601.1| mitotic-spindle organizing protein 1 [Lingula anatina] Length = 78 Score = 70.1 bits (170), Expect = 2e-13 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVSLKSFD 202 L E+S LLNTGLD +TL++ ++LCE+GVNPEALA VI+ELRRES +LK D Sbjct: 19 LLEISNLLNTGLDAETLAICVSLCESGVNPEALATVIQELRRESAALKETD 69 >ref|XP_004364387.1| hypothetical protein CAOG_01519 [Capsaspora owczarzaki ATCC 30864] gb|KJE90174.1| hypothetical protein CAOG_001519 [Capsaspora owczarzaki ATCC 30864] Length = 65 Score = 69.7 bits (169), Expect = 2e-13 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRES 223 L EMS LL+TGLDR+TL++ ++LCE+GVNPEALAAV+KELRRES Sbjct: 16 LFEMSKLLDTGLDRETLAICVSLCESGVNPEALAAVVKELRRES 59 >gb|EQL27805.1| mitotic-spindle organizing protein 1, variant [Blastomyces dermatitidis ATCC 26199] gb|KMW69524.1| mitotic-spindle organizing protein 1, variant [Blastomyces dermatitidis ATCC 18188] gb|OAT00142.1| mitotic-spindle organizing protein 1, variant [Blastomyces dermatitidis ER-3] gb|OAT07888.1| mitotic-spindle organizing protein 1, variant [Blastomyces gilchristii SLH14081] Length = 80 Score = 69.7 bits (169), Expect = 3e-13 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -3 Query: 354 LHEMSTLLNTGLDRDTLSLSLNLCENGVNPEALAAVIKELRRESVS 217 LHE+ST+LNT LDR LSL ++L ENGVNPEALAAVIKELRRE+V+ Sbjct: 22 LHEISTILNTHLDRTELSLCVSLIENGVNPEALAAVIKELRREAVA 67