BLASTX nr result
ID: Ophiopogon26_contig00040497
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040497 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX69901.1| hypothetical protein RirG_092250 [Rhizophagus irr... 256 6e-82 >gb|EXX69901.1| hypothetical protein RirG_092250 [Rhizophagus irregularis DAOM 197198w] dbj|GBC45943.1| RNA polymerase II-associated factor 1 [Rhizophagus irregularis DAOM 181602] gb|PKC16942.1| hypothetical protein RhiirA5_466331 [Rhizophagus irregularis] gb|PKC76041.1| hypothetical protein RhiirA1_406853 [Rhizophagus irregularis] gb|PKK79365.1| hypothetical protein RhiirC2_727400 [Rhizophagus irregularis] gb|PKY13404.1| hypothetical protein RhiirB3_398764 [Rhizophagus irregularis] gb|PKY37743.1| hypothetical protein RhiirA4_530850 [Rhizophagus irregularis] gb|POG64010.1| RNA polymerase II-associated [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 442 Score = 256 bits (655), Expect = 6e-82 Identities = 124/125 (99%), Positives = 124/125 (99%) Frame = -2 Query: 376 MSSSKSKNKNRADFNYICSLKYRHIPPTPEHLPLDLSWNVDLNYLTEPDSFFESFQASRL 197 MSSSKSKNKNRADFNYICSLKYRHIPPTPEHLPLDLSWNVDLNYLTEPDSFFESFQASRL Sbjct: 1 MSSSKSKNKNRADFNYICSLKYRHIPPTPEHLPLDLSWNVDLNYLTEPDSFFESFQASRL 60 Query: 196 PLISDYDLGMKTELSDYPGLFLGDESGLNPRRETTSFDINDQALLCVGKDPVTVNQDLPR 17 PLISDYDLGMKTELSDYPGLFLGDESGLNPRRETTSFDINDQALLCVGKDPVTVNQDL R Sbjct: 61 PLISDYDLGMKTELSDYPGLFLGDESGLNPRRETTSFDINDQALLCVGKDPVTVNQDLSR 120 Query: 16 LKRLS 2 LKRLS Sbjct: 121 LKRLS 125