BLASTX nr result
ID: Ophiopogon26_contig00040298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040298 (1304 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC31593.1| hypothetical protein RIR_1689000 [Rhizophagus ir... 50 5e-10 gb|POG70699.1| hypothetical protein GLOIN_2v1613821 [Rhizophagus... 62 6e-08 >dbj|GBC31593.1| hypothetical protein RIR_1689000 [Rhizophagus irregularis DAOM 181602] Length = 70 Score = 49.7 bits (117), Expect(2) = 5e-10 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +1 Query: 634 HCCHTSHDIDSSRTLNITITNELLKEEEIVRYCL 735 HCCHTSHDID IT+TNELLKEEEI+ YC+ Sbjct: 16 HCCHTSHDID------ITVTNELLKEEEIL-YCM 42 Score = 44.7 bits (104), Expect(2) = 5e-10 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 845 KRECRTKTPQNTMHAHFNQ 901 KRECRTKTPQ+TMHAHFNQ Sbjct: 49 KRECRTKTPQDTMHAHFNQ 67 >gb|POG70699.1| hypothetical protein GLOIN_2v1613821 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 129 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 738 VNDFILLNFRHFFSILSQNPLWFTVAILYAIA 833 +NDFILLNFRHFFSIL QNPLWFTV ILY I+ Sbjct: 1 MNDFILLNFRHFFSILGQNPLWFTVTILYGIS 32