BLASTX nr result
ID: Ophiopogon26_contig00040272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040272 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY51209.1| hypothetical protein RhiirA4_546430 [Rhizophagus ... 69 2e-13 >gb|PKY51209.1| hypothetical protein RhiirA4_546430 [Rhizophagus irregularis] Length = 173 Score = 68.9 bits (167), Expect(2) = 2e-13 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = -3 Query: 268 VHFTNHKDVSNFFYTMSGRDFNGTNGHIRFKESLIFD 158 V FTNHKD SNFFYTMS RDFNGTNG IRFKESL FD Sbjct: 5 VRFTNHKDASNFFYTMSRRDFNGTNGPIRFKESLRFD 41 Score = 33.9 bits (76), Expect(2) = 2e-13 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 155 DKFSQLYQRTDHHDI 111 DKFSQLYQRTDHH + Sbjct: 42 DKFSQLYQRTDHHGV 56